Recombinant Brucella abortus biovar 1 Putative peptide transport system permease protein BruAb2_1032 (BruAb2_1032)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

BruAb2_1032 is a recombinant protein derived from Brucella abortus biovar 1, a zoonotic pathogen causing brucellosis. It is a permease component of an ATP-binding cassette (ABC) transporter system tasked with importing peptides into the bacterial cell. This system is critical for nutrient acquisition and intracellular survival, particularly during infection .

Functional Role

BruAb2_1032 operates as part of an ABC transporter, facilitating peptide import. These transporters are essential for bacterial growth, particularly under nutrient-limited conditions, such as during intracellular infection .

Intracellular Survival and Virulence

A related permease, BruAb2_1031, was identified as critical for peptide uptake in Brucella abortus. Mutations in BruAb2_1031 increased bacterial survival in RAW 264.7 macrophages, suggesting impaired peptide transport may alter host immune responses . While BruAb2_1032 has not been directly studied in this context, its homology to BruAb2_1031 implies a similar role in nutrient acquisition and pathogenesis.

Host-Pathogen Interaction

ABC transporters like BruAb2_1032 may modulate host immune evasion. For example, peptide uptake systems have been linked to antigen presentation and cytokine regulation in Brucella-infected cells .

Experimental Uses

  • Vaccine Development: ABC permeases are potential vaccine targets due to their role in bacterial survival .

  • Enzyme Activity Assays: Recombinant BruAb2_1032 can be used to study peptide transport kinetics in vitro .

  • Protein-Protein Interactions: His-tagged versions enable affinity purification for interaction studies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method and location. Please contact your local distributors for specific delivery time details.
Note: All protein shipments default to normal blue ice packs. If dry ice shipment is required, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
BruAb2_1032; Putative peptide transport system permease protein BruAb2_1032
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-296
Protein Length
full length protein
Species
Brucella abortus biovar 1 (strain 9-941)
Target Names
BruAb2_1032
Target Protein Sequence
MTELASPTSFSMPDIGKSPVVLTARRLMRHRSFRIGLVLLLIVVLAAVLAPWITNGKPNA TSVRMRFQPPGLEHLFGTDNFGRDLWTRVLYGAQVSLWIGLTVAVLSAILGAIIGIAAAW YRRFDTLLMRVMDALMAFPAILLAIGISAALGPHLSSVIIALTSAYIPRCARIVRASALV LRETDYVDAARLAGASDLRIITRHILPNCLAPLLVTLTFVFAYAILAEATLSFLGIGTPP PHASWGSIVAQGRDYSVDAWWIMLFPGIAITISALAINLIGDGLRDVLDPRLKMEG
Uniprot No.

Target Background

Function
Likely a component of an ABC transporter complex potentially involved in peptide import. It is likely responsible for substrate translocation across the membrane.
Database Links
Protein Families
Binding-protein-dependent transport system permease family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the primary structure and functional classification of BruAb2_1032?

BruAb2_1032 is a full-length protein consisting of 296 amino acids that functions as a putative peptide transport system permease protein in Brucella abortus biovar 1. The protein has been identified as a component of ATP-Binding Cassette (ABC) transport systems, which are critical for nutrient acquisition in Brucella species. The complete amino acid sequence of BruAb2_1032 is:

MTELASPTSFSMPDIGKSPVVLTARRLMRHRSFRIGLVLLLIVVLAAVLAPWITNGKPNATSVRMRFQPPGLEHLFGTDNFGRDLWTRVLYGAQVSLWIGLTVAVLSAILGAIIGIAAAWYRRFDTLLMRVMDALMAFPAILLAIGISAALGPHLSSVIIALTSAYIPRCARIVRASALVLRETDYVDAARLAGASDLRIITRHILPNCLAPLLVTLTFVFAYAILAEATLSFLGIGTPPPHASWGSIVAQGRDYSVDAWWIMLFPGIAITISALAINLIGDGLRDVLDPRLKMEG

The protein has been characterized with an N-terminal His tag when expressed recombinantly in E. coli systems, which facilitates purification through affinity chromatography methods. As a permease protein, BruAb2_1032 is embedded in the bacterial inner membrane and forms the transmembrane component of the ABC transporter complex responsible for facilitating the passage of peptides across the membrane .

How is BruAb2_1032 classified within the ABC transporter systems of Brucella species?

BruAb2_1032 belongs to the ATP-Binding Cassette (ABC) transporter systems, which represent a significant proportion of transport mechanisms in Brucella species. ABC systems in Brucella are categorized based on their structural components and functional roles. A comprehensive comparison of ABC systems across five Brucella species (B. melitensis, B. abortus, B. suis, B. canis, and B. ovis) reveals significant conservation but also species-specific variations .

Within the classification system, BruAb2_1032 functions as an inner membrane (IM) component of a peptide transport system. ABC transporters typically consist of multiple components including:

  • ATP-binding cassette (ABC) proteins that provide energy through ATP hydrolysis

  • Inner membrane (IM) proteins like BruAb2_1032 that form the transmembrane channel

  • Substrate-binding proteins (often lipoproteins, LPP) that capture the target molecules

The functional ABC systems vary numerically between Brucella species (B. melitensis: 79, B. suis: 72, B. abortus: 64, B. canis: 74, B. ovis: 59), suggesting differences in transport capabilities that may correlate with host preference and virulence profiles .

What are the predicted topological features of BruAb2_1032 as a membrane protein?

As a permease protein component of an ABC transport system, BruAb2_1032 is predicted to contain multiple transmembrane domains that span the bacterial inner membrane. Computational analysis of the amino acid sequence indicates hydrophobic regions consistent with transmembrane helices interspersed with hydrophilic loops that extend into either the cytoplasm or periplasm.

The protein sequence analysis suggests:

  • Multiple transmembrane alpha-helical segments that form the channel through which peptides are transported

  • Cytoplasmic domains that likely interact with the ATP-binding component of the transporter

  • Conserved motifs characteristic of ABC transporter permease components

These structural features align with the functional classification of BruAb2_1032 as a peptide transport system permease protein. The transmembrane domains create a specific pathway through which peptide substrates can cross the bacterial inner membrane, a process energized by ATP hydrolysis at the associated ATP-binding protein .

What are the optimal expression and purification methods for recombinant BruAb2_1032?

For optimal expression of recombinant BruAb2_1032, E. coli has been established as an effective heterologous host system. The protein is typically expressed with an N-terminal His-tag to facilitate purification. The expression construct should contain the full-length sequence (amino acids 1-296) of BruAb2_1032 cloned into an appropriate expression vector with an inducible promoter system .

The recommended purification protocol involves:

  • Cell lysis: Disruption of E. coli cells using sonication or pressure-based methods in a buffer containing protease inhibitors to prevent degradation.

  • Membrane fraction isolation: As a membrane protein, BruAb2_1032 requires detergent solubilization from the membrane fraction. This typically involves ultracentrifugation to isolate membranes followed by solubilization using mild detergents like n-Dodecyl β-D-maltoside (DDM) or n-Octyl-β-D-glucopyranoside (OG).

  • Affinity chromatography: The His-tagged protein can be purified using immobilized metal affinity chromatography (IMAC). This typically employs nickel or cobalt resins with elution using an imidazole gradient.

  • Size exclusion chromatography: A final polishing step using gel filtration helps remove aggregates and ensures a homogeneous protein preparation.

The purified protein is typically stored in a buffer containing Tris/PBS with 6% trehalose at pH 8.0. For long-term storage, it is recommended to add glycerol to a final concentration of 50% and store aliquots at -20°C or -80°C to avoid repeated freeze-thaw cycles that can compromise protein integrity .

What functional assays can be employed to characterize BruAb2_1032 activity?

To assess the functional activity of BruAb2_1032 as a permease component of a peptide transport system, several complementary approaches can be implemented:

  • Reconstitution into proteoliposomes: The purified BruAb2_1032 can be reconstituted into artificial liposomes along with its corresponding ATP-binding protein to form a functional transport unit. Transport activity can then be measured using radiolabeled or fluorescently labeled peptide substrates.

  • ATPase activity assays: While BruAb2_1032 itself doesn't hydrolyze ATP, its interaction with the ATP-binding component can be assessed by measuring changes in ATPase activity in the presence of substrate peptides.

  • Substrate binding assays: Using techniques such as isothermal titration calorimetry (ITC) or surface plasmon resonance (SPR) to measure the binding affinity of potential peptide substrates to the reconstituted transport system.

  • Growth complementation assays: Functional complementation studies in E. coli strains deficient in peptide transport can demonstrate the in vivo functionality of BruAb2_1032 when expressed together with other components of the transport system.

  • Transport assays in whole cells: Measuring the uptake of labeled peptide substrates in bacterial cells expressing the complete transport system can provide insights into the transport kinetics and substrate specificity.

These assays collectively provide a comprehensive evaluation of the protein's role in peptide transport across bacterial membranes, which is crucial for understanding its contribution to Brucella biology and pathogenesis .

What structural characterization techniques are most appropriate for studying BruAb2_1032?

As a membrane protein, BruAb2_1032 presents particular challenges for structural characterization. The following methodological approaches are recommended for elucidating its structural features:

These complementary approaches can collectively provide insights into the structural organization of BruAb2_1032 and its conformational changes during the transport cycle, which are essential for understanding its mechanism of action .

How conserved is BruAb2_1032 across different Brucella species and what does this suggest about its functional importance?

Comparative genomic analysis across five Brucella species (B. melitensis, B. abortus, B. suis, B. canis, and B. ovis) provides insights into the conservation of BruAb2_1032 and its orthologs. The gene is present in all these species, suggesting a fundamental role in Brucella biology .

The following table illustrates the presence of this permease protein across different Brucella species:

Brucella SpeciesOrtholog IdentifierPresent/Absent
B. abortusBruAb2_1032Present
B. melitensisBMEII corresponding locusPresent
B. suisBRA corresponding locusPresent
B. canisBCAN corresponding locusPresent
B. ovisBOV corresponding locusPresent

The high conservation of this protein across species with different host preferences (B. abortus primarily infects cattle, B. melitensis infects goats and sheep, B. suis infects pigs, B. canis infects dogs, and B. ovis infects sheep) suggests that the peptide transport function is essential for the core biology of Brucella, independent of host specificity .

Interestingly, while the total number of ABC systems varies between species (from 59 in B. ovis to 79 in B. melitensis), the conservation of this particular system indicates its importance. Sequence variations in the orthologs might reflect adaptations to different host environments or substrate preferences that have evolved in each species lineage.

How does BruAb2_1032 fit into the broader context of ABC transporter systems in Brucella abortus?

BruAb2_1032 functions as part of the broader network of ABC transporter systems in Brucella abortus. ABC systems are particularly abundant in Brucella species, with a significant emphasis on nutrient importers, reflecting their adaptation to intracellular lifestyle. B. abortus contains 64 ABC systems in total, categorized into different functional groups .

The table below outlines the major categories of ABC systems in Brucella abortus and contextualizes where BruAb2_1032 fits within this framework:

ABC System CategoryFunctionExamples in B. abortusRelation to BruAb2_1032
Nutrient ImportersImport of essential nutrients (amino acids, peptides, sugars, metals)Peptide transporters, Amino acid transportersBruAb2_1032 functions as a permease component of a peptide import system
ExportersExport of toxins, lipids, proteinsLipid exporters, Protein exportersDistinct functional category from BruAb2_1032
Cellular ProcessCell division, DNA repairFtsE/X systemFunctionally distinct from BruAb2_1032
Gene Expression RegulationRegulatory functionsART familyFunctionally distinct from BruAb2_1032

BruAb2_1032 specifically belongs to the peptide transport systems, which are crucial for nutrient acquisition during intracellular growth. Peptide transporters allow Brucella to utilize host-derived peptides as nutrient sources, which is particularly important during intracellular growth within host macrophages. The presence of multiple peptide transport systems in Brucella species highlights the importance of this nutrient acquisition strategy for their pathogenic lifestyle .

What is the specific role of BruAb2_1032 in peptide transport and how does this contribute to Brucella physiology?

BruAb2_1032 functions as the permease component of a peptide transport system, forming the transmembrane channel through which peptides are transported across the bacterial inner membrane. This protein is integral to the nutrient acquisition strategy of Brucella abortus, particularly during its intracellular phase within host cells.

The functional significance of BruAb2_1032 can be understood through the following mechanisms:

  • Nutrient acquisition: By facilitating peptide import, BruAb2_1032 enables B. abortus to utilize host-derived peptides as sources of amino acids, nitrogen, and carbon. This is especially crucial during intracellular growth within nutrient-limited compartments of host macrophages.

  • Amino acid scavenging: Rather than synthesizing all amino acids de novo, Brucella can conserve energy by importing peptides and degrading them into constituent amino acids for protein synthesis. This represents an efficient adaptive strategy for intracellular survival.

  • Sensing environmental signals: Peptide transporters can potentially function as sensors for specific peptides that may signal host environmental conditions, allowing the bacterium to adapt accordingly.

  • Contribution to stress resistance: Certain imported peptides may contribute to stress resistance mechanisms, particularly against antimicrobial peptides or oxidative stress encountered within the host.

The full functional complex includes an ATP-binding protein that provides energy through ATP hydrolysis and potentially a substrate-binding protein that initially captures the peptide substrates in the periplasm. The complete transport system operates through conformational changes driven by ATP binding and hydrolysis, with BruAb2_1032 undergoing structural rearrangements to alternatively expose the substrate-binding site to either side of the membrane .

How might BruAb2_1032 contribute to Brucella abortus virulence and intracellular survival?

The role of BruAb2_1032 in Brucella virulence likely stems from its function in nutrient acquisition during intracellular infection. Several potential mechanisms link this permease protein to virulence:

  • Nutritional virulence: By enabling efficient uptake of host-derived peptides, BruAb2_1032 contributes to the nutritional adaptation of Brucella within host cells. This ability to scavenge nutrients from the host environment is a fundamental aspect of pathogen fitness during infection.

  • Metabolic adaptation: The peptide transport system containing BruAb2_1032 allows metabolic flexibility by providing access to host-derived peptides as alternative nutrient sources. This adaptability is crucial for survival in the changing environment of the host cell.

  • Evasion of nutritional immunity: Hosts restrict pathogen access to essential nutrients as a defense mechanism (nutritional immunity). Efficient peptide transport systems may help Brucella overcome these restrictions by accessing peptide-bound nutrients.

  • Contribution to intracellular trafficking: Some bacterial transporters influence intracellular trafficking and vacuolar maturation. While direct evidence for BruAb2_1032 in this process is lacking, peptide transporters might influence the Brucella-containing vacuole's properties.

What are the potential applications of BruAb2_1032 as a therapeutic target for brucellosis?

BruAb2_1032, as a bacterial permease protein with no direct human homolog, represents a potentially valuable therapeutic target for developing novel treatments against brucellosis. Several characteristics make it particularly attractive for drug development:

  • Essential function: If peptide transport mediated by BruAb2_1032 is essential for intracellular survival and virulence, inhibitors would potentially have bactericidal or bacteriostatic effects.

  • Surface accessibility: As a membrane protein, certain domains of BruAb2_1032 may be accessible from the periplasmic space, making them potentially targetable by small molecule inhibitors.

  • Structural uniqueness: The structural features of bacterial ABC transporters differ sufficiently from human transporters, potentially allowing for selective targeting with minimal host toxicity.

Therapeutic strategies that could be developed against BruAb2_1032 include:

  • Competitive inhibitors: Small molecules that mimic peptide substrates but cannot be transported, thereby blocking the transport channel.

  • Allosteric inhibitors: Compounds that bind to regulatory sites on the protein and induce conformational changes that prevent normal function.

  • Peptidomimetic drugs: Modified peptides that specifically bind to BruAb2_1032 with high affinity, blocking its transport function.

  • Antibody-based approaches: For periplasmic-exposed domains, specific antibodies could potentially neutralize function.

Research approaches to develop such therapeutics would require:

  • High-resolution structural studies of BruAb2_1032

  • Development of functional assays for high-throughput screening

  • In silico docking studies to identify potential inhibitory compounds

  • Validation in cellular and animal models of Brucella infection

The conservation of this protein across Brucella species suggests that therapeutics targeting BruAb2_1032 might be effective against multiple Brucella species that cause human brucellosis .

What experimental approaches could be used to identify interaction partners of BruAb2_1032?

Understanding the protein-protein interaction network of BruAb2_1032 is crucial for elucidating its complete functional context within Brucella abortus. Several complementary experimental approaches can be employed to identify its interaction partners:

  • Bacterial two-hybrid system: This system, adapted for membrane proteins, can detect binary interactions between BruAb2_1032 and other bacterial proteins. It involves creating fusion proteins with split reporter domains that reconstitute activity when brought together by interacting proteins.

  • Pull-down assays with purified BruAb2_1032: His-tagged BruAb2_1032 can be used as bait to capture interacting proteins from bacterial lysates. Captured proteins are then identified by mass spectrometry. This approach requires careful optimization of detergent conditions to maintain membrane protein interactions.

  • Chemical cross-linking coupled with mass spectrometry (XL-MS): This technique involves chemical cross-linking of proteins in their native environment followed by proteolytic digestion and mass spectrometric analysis to identify cross-linked peptides, revealing proteins in close proximity to BruAb2_1032.

  • Co-immunoprecipitation with antibodies against BruAb2_1032: Specific antibodies can be used to precipitate BruAb2_1032 along with its interacting partners from solubilized bacterial membranes.

  • Genetic interaction screens: Synthetic lethal or synthetic sick screens can identify genes that have functional relationships with BruAb2_1032, potentially revealing interaction partners or proteins in related pathways.

  • Proximity-based labeling approaches: Techniques like BioID or APEX, which involve fusion of BruAb2_1032 with a biotin ligase or peroxidase, can label proximal proteins in living bacteria for subsequent purification and identification.

Expected interaction partners likely include:

  • The ATP-binding protein component of the same ABC transporter complex

  • Substrate-binding proteins that capture peptides in the periplasm

  • Regulatory proteins that modulate transporter activity

  • Components of peptidase systems that process imported peptides

  • Membrane scaffold proteins that may organize transporter complexes

These approaches collectively would provide a comprehensive view of the protein interaction network centered on BruAb2_1032, offering insights into its functional context within the bacterial cell .

What are the key knowledge gaps and future research directions regarding BruAb2_1032?

Despite the available information on BruAb2_1032, several significant knowledge gaps remain that represent important directions for future research:

  • Substrate specificity: The exact peptide substrate preferences of the transport system containing BruAb2_1032 remain unknown. Determining which peptides are transported would provide insights into its physiological role and potential for targeting.

  • Three-dimensional structure: No high-resolution structure is available for BruAb2_1032. Structural studies would reveal the molecular basis of transport and identify potential binding sites for inhibitor development.

  • Transport mechanism: The conformational changes and molecular events involved in peptide transport by BruAb2_1032 and its associated components need to be elucidated.

  • Regulation of expression: The regulatory mechanisms controlling BruAb2_1032 expression during infection and under different environmental conditions remain to be characterized.

  • In vivo significance: The specific contribution of BruAb2_1032 to virulence and intracellular survival in relevant animal models of brucellosis requires investigation through targeted mutation studies.

Future research directions should include:

  • Structural biology approaches: Cryo-EM, X-ray crystallography, or other structural techniques to determine the three-dimensional structure of BruAb2_1032 alone and in complex with other transporter components.

  • Substrate identification: Developing assays to identify the specific peptide substrates transported by this system, potentially using metabolomics approaches.

  • Genetic manipulation studies: Creation of deletion or conditional mutants of BruAb2_1032 to assess its role in virulence and intracellular survival in cellular and animal models.

  • Transcriptomic and proteomic analysis: Characterization of expression patterns during different phases of infection and in response to environmental stresses.

  • Inhibitor development: Structure-based design of specific inhibitors targeting BruAb2_1032 as potential therapeutic agents against brucellosis.

Addressing these knowledge gaps would significantly advance our understanding of BruAb2_1032's role in Brucella biology and potentially lead to new therapeutic strategies against brucellosis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.