Recombinant Brucella abortus biovar 1 sn-glycerol-3-phosphate transport system permease protein ugpA (ugpA)

Shipped with Ice Packs
In Stock

Description

Role in Brucella Pathogenesis

  • Nutrient Acquisition: ABC transporters like UgpA enable Brucella to import essential nutrients (e.g., G3P) during intracellular growth, supporting replication in host cells .

  • Stress Adaptation: ABC transporters are upregulated during stationary growth, aiding Brucella survival under nutrient-limiting conditions .

  • Potential Virulence Factor: ABC transporters in pathogens often contribute to evading host immune responses or colonizing niches .

Research Applications

ApplicationDescriptionRelevance
Metabolic StudiesInvestigating G3P transport kinetics and energy metabolism in Brucella.Elucidating survival mechanisms.
Vaccine DevelopmentAssessing immunogenicity as a candidate antigen for serological diagnostics.Limited evidence; ABC proteins may elicit immune responses .
Drug TargetingDesigning inhibitors targeting ABC transporters to disrupt Brucella metabolism.ABC transporters are conserved targets.

Comparison with Other Recombinant UgpA Proteins

The following table contrasts B. abortus biovar 1 ugpA with homologs from other Brucella species:

Species/BiovarHost SystemPurityTagsProduct CodeSource
B. abortus biovar 1Cell-free≥85%None reportedMBS7032757
B. suis biovar 1E. coli≥85%His-taggedRFL12039BF
B. melitensis biovar 1Cell-free≥85%None reportedMBS7032761
Shigella flexneri (partial)E. coli/yeast≥85%None reportedMBS7032770

Key Observations:

  • Host Diversity: B. abortus biovar 1 ugpA is typically expressed in cell-free systems, while B. suis uses E. coli.

  • Tag Variability: His-tagged versions (e.g., B. suis) facilitate purification but are absent in B. abortus .

Research Gaps and Future Directions

  1. Functional Validation: Direct studies on B. abortus biovar 1 ugpA’s role in G3P transport and pathogenesis are needed.

  2. Immunogenicity Profiling: Assessing its utility as a diagnostic marker or vaccine antigen.

  3. Structural Studies: Resolving crystal structures to identify binding sites for substrate/inhibitor design.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a useful reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ugpA; BruAb2_0570; sn-glycerol-3-phosphate transport system permease protein UgpA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-293
Protein Length
full length protein
Species
Brucella abortus biovar 1 (strain 9-941)
Target Names
ugpA
Target Protein Sequence
MQKVTFPNKILPYFLLAPQIVLTVVFFFWPASQAIYQSFMREDAFGLKSTFVELANFTAV LSDPNYLHSVQVTVVFNVLTALLAMGVALLLATAADRVIRGQTFYRTLLIWPYAVAPAVA GMLWLFIFNPAMGTFAYLLRRNGIAWDPLLDGNQAMGLVVVAAAWKQISYNFLFFVAGLQ AIPKSLIEAAAIDGARGARRFWTIVFPLLAPTSFFLLVVNTVYAFFDTFGIIHAVTGGGP AKATETLVYKVYNDGFVNLNLGSSSAQSVILMAIVIALTAFQFRFVEKRVHYS
Uniprot No.

Target Background

Function
A component of the ABC transporter complex UgpABCE, involved in the import of sn-glycerol-3-phosphate. It is likely responsible for substrate translocation across the membrane.
Database Links
Protein Families
Binding-protein-dependent transport system permease family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the ugpA protein in Brucella abortus biovar 1 and what is its function?

The ugpA protein in Brucella abortus biovar 1 is a permease component of the sn-glycerol-3-phosphate (G3P) transport system. It functions as part of a binding protein-dependent transport system that facilitates the uptake of G3P into bacterial cells. This system is particularly important during phosphate starvation conditions when the bacterium needs alternative phosphate sources. The ugp-dependent transport system is induced under phosphate starvation conditions and is regulated as part of the pho regulon . As a membrane permease, ugpA forms part of the transmembrane channel through which G3P molecules are transported from the periplasmic space into the cytoplasm.

How is the ugpA gene organized in the Brucella abortus genome?

The ugpA gene is located in the Brucella abortus genome, which consists of two circular chromosomes of 2,124,242 bp (Chr I) and 1,162,780 bp (Chr II) with a total genome size of approximately 3.3 Mb . The genome has a high G+C content of approximately 57.2-57.3%, consistent across both chromosomes . Though the search results don't specify the exact location of ugpA, the gene is likely organized as part of an operon structure with other ugp genes involved in the G3P transport system, similar to what is observed in related bacterial species. The Brucella abortus genome contains 3,296 annotated open reading frames (ORFs), with 2,158 on Chr I and 1,138 on Chr II .

What are the key characteristics of binding protein-dependent transport systems like the one containing ugpA?

Binding protein-dependent transport systems, including the ugp system containing ugpA, have several distinctive characteristics:

  • They require a periplasmic binding protein that captures the substrate in the periplasmic space

  • They are highly sensitive to osmotic shock, which disrupts the periplasmic components

  • They do not function in membrane vesicles due to the absence of the periplasmic binding protein

  • The periplasmic binding protein is necessary but not sufficient for transport activity

  • They require additional membrane components (like ugpA) to form a functional transport complex

These transport systems are typically composed of multiple proteins: a substrate-binding protein located in the periplasm, membrane-embedded proteins (including permeases like ugpA) that form a channel, and an ATP-binding protein that provides energy for the transport process through ATP hydrolysis .

What are the optimal approaches for cloning and expressing recombinant ugpA protein?

For cloning and expressing recombinant ugpA protein, researchers should consider the following approach:

  • Gene Amplification: Design specific primers based on the ugpA sequence from Brucella abortus biovar 1 genome, which has been fully sequenced .

  • Expression Vector Selection: Similar to other Brucella proteins, a cold shock expression vector like pCold-TF can be used, which has demonstrated success in expressing recombinant Brucella proteins .

  • Host Selection: E. coli expression systems (such as BL21) are commonly used for recombinant Brucella proteins.

  • Induction Conditions: Optimize induction conditions (temperature, IPTG concentration, induction time) to maximize protein yield while maintaining proper folding.

  • Purification Strategy: Utilize affinity chromatography (typically His-tag purification) followed by size exclusion chromatography to obtain highly pure protein.

  • Protein Verification: Confirm the identity and reactivity of the recombinant protein using immunoblotting with Brucella-positive serum, as demonstrated with other Brucella recombinant proteins .

The expression system should be chosen carefully to ensure the recombinant protein maintains its native conformation and antigenic properties, which is critical for subsequent functional and immunological studies.

How should researchers design experiments to study the function of ugpA in sn-glycerol-3-phosphate transport?

When designing experiments to study ugpA function in G3P transport, researchers should implement a multi-faceted approach:

  • Gene Knockout Studies: Create ugpA deletion mutants in Brucella abortus and assess their ability to transport G3P compared to wild-type strains. This approach helps establish the necessity of ugpA for G3P transport.

  • Complementation Assays: Reintroduce the functional ugpA gene into knockout mutants to confirm that phenotypic changes are specifically due to ugpA absence.

  • Transport Assays: Measure the uptake of radiolabeled G3P (e.g., [14C]sn-glycerol-3-phosphate) in wild-type, mutant, and complemented strains under various conditions, particularly phosphate starvation .

  • Osmotic Shock Experiments: Assess transport activity before and after osmotic shock to confirm the binding protein-dependent nature of the transport system .

  • Regulatory Studies: Examine ugpA expression under phosphate starvation and in pho regulon constitutive mutants to understand regulatory mechanisms .

  • Inhibitor Studies: Use analogs like 3,4-dihydroxybutyl-1-phosphonate that are transported by the system to further characterize transport specifics .

  • Control Variables: Include appropriate controls such as measuring transport in membrane vesicles (where binding protein-dependent systems don't operate) and using strains with altered phosphate metabolism .

This systematic approach allows for comprehensive characterization of ugpA's role in G3P transport and its regulation under different physiological conditions.

What are the best methods for analyzing ugpA protein interactions with other components of the transport system?

To analyze ugpA protein interactions with other components of the G3P transport system, researchers should employ these methodological approaches:

  • Co-immunoprecipitation (Co-IP): Use antibodies against ugpA to pull down protein complexes, followed by mass spectrometry to identify interacting partners.

  • Bacterial Two-Hybrid Assays: Adapt bacterial two-hybrid systems to screen for direct protein-protein interactions between ugpA and other components of the transport system.

  • Cross-linking Studies: Utilize chemical cross-linkers to stabilize transient protein-protein interactions within the bacterial membrane, followed by identification of cross-linked complexes.

  • FRET (Förster Resonance Energy Transfer): Label ugpA and potential interacting proteins with fluorescent tags to detect interactions in vivo based on energy transfer.

  • Site-Directed Mutagenesis: Create specific mutations in ugpA to identify domains important for protein-protein interactions and transport function.

  • Pull-down Assays: Perform in vitro pull-down assays using purified recombinant components of the transport system to verify direct interactions.

  • Proteoliposome Reconstitution: Reconstitute the transport system in artificial membrane vesicles using purified components to study functional interactions.

These methods should be used in combination to build a comprehensive understanding of how ugpA interacts with other proteins, particularly the periplasmic binding protein and other membrane components of the G3P transport system.

How does ugpA contribute to Brucella abortus pathogenesis and survival within host cells?

The contribution of ugpA to Brucella abortus pathogenesis and intracellular survival involves several critical aspects:

Advanced research would need to specifically investigate ugpA knockout mutants in cell infection models and animal models to definitively establish its role in virulence and intracellular survival of Brucella abortus.

What structural adaptations in ugpA enable efficient sn-glycerol-3-phosphate transport across the bacterial membrane?

The structural adaptations in ugpA that enable efficient G3P transport involve specific protein architecture optimized for this function:

  • Transmembrane Domains: ugpA likely contains multiple transmembrane helices that span the bacterial inner membrane, forming part of the channel through which G3P molecules pass. These transmembrane domains would be arranged to create a selective pore with specificity for G3P.

  • Substrate Binding Sites: Specific amino acid residues within ugpA likely form binding sites that recognize and interact with G3P molecules, facilitating their movement through the membrane channel.

  • Interaction Interfaces: ugpA would have dedicated protein-protein interaction domains that allow it to associate with other components of the transport system, including the periplasmic binding protein and ATP-binding protein.

  • Conformational Flexibility: The protein likely undergoes conformational changes during the transport cycle, alternating between inward-facing and outward-facing states to move G3P across the membrane.

  • Regulatory Domains: Structural elements that respond to regulatory signals (such as phosphate limitation) may be present to control the activity of the transport system.

A detailed structural analysis of ugpA using X-ray crystallography or cryo-electron microscopy would be necessary to fully elucidate these structural features and their functional significance in G3P transport.

How can researchers address challenges in studying membrane proteins like ugpA in Brucella species?

Researchers face several challenges when studying membrane proteins like ugpA in Brucella, which can be addressed through these advanced approaches:

  • Solubilization Strategies: Optimize detergent selection for membrane protein extraction, considering newer detergents like styrene-maleic acid lipid particles (SMALPs) that maintain the native lipid environment around the protein.

  • Expression Systems: Use specialized expression systems designed for membrane proteins, such as C41/C43 E. coli strains or cell-free expression systems supplemented with lipids or nanodiscs.

  • Fusion Partners: Employ fusion partners that enhance membrane protein folding and stability, such as GFP for tracking expression and folding, or maltose-binding protein to improve solubility.

  • Nanobody Technologies: Develop nanobodies against ugpA to stabilize specific conformations for structural studies and as tools for functional analysis.

  • Native Membrane Environment Preservation: Use approaches like native mass spectrometry or hydrogen-deuterium exchange mass spectrometry that can analyze membrane proteins in their near-native environment.

  • Computational Approaches: Implement molecular dynamics simulations to predict protein-lipid interactions and structural changes during transport cycles when experimental data is limited.

  • Advanced Microscopy: Apply super-resolution microscopy techniques to study ugpA localization and dynamics in intact bacterial cells.

  • Biosafety Considerations: Develop surrogate systems using non-pathogenic bacterial species expressing Brucella ugpA to overcome biosafety restrictions associated with working with Category B bioterrorism agents .

These methodological approaches can help overcome the inherent difficulties in studying membrane proteins from pathogenic organisms while yielding meaningful structural and functional data.

How should researchers interpret contradictory results when studying ugpA functionality in different experimental systems?

When faced with contradictory results regarding ugpA functionality across different experimental systems, researchers should apply the following analytical framework:

  • System-Specific Factors Analysis: Systematically compare the experimental systems, identifying differences in:

    • Host strain genetic backgrounds

    • Expression levels of ugpA and other transport components

    • Membrane composition differences

    • Growth conditions and induction protocols

    • Presence of native vs. recombinant forms of the protein

  • Multiple Methodological Validation: Verify findings using complementary techniques to rule out method-specific artifacts. For example, if transport assays show contradictory results to growth phenotypes, use radioactive substrate tracking to provide direct evidence of transport activity .

  • Control Experiments: Implement rigorous controls specific to each experimental system. For instance, when studying the ugp system's ability to support growth on G3P as a carbon source, consider testing strains with different metabolic backgrounds to identify potential metabolic bottlenecks beyond transport .

  • Data Integration Table: Create a comprehensive table comparing results across different experimental systems:

Experimental SystemugpA ExpressionG3P Transport ActivityGrowth on G3P as Carbon SourceGrowth on G3P as Phosphate SourcePossible Explanation for Discrepancies
Native BrucellaEndogenous[Result][Result][Result][Analysis]
E. coli (recombinant)Overexpressed[Result][Result][Result][Analysis]
In vitro liposomesPurified protein[Result]N/AN/A[Analysis]
Knockout complementationControlled[Result][Result][Result][Analysis]
  • Contextual Interpretation: Consider that the ugp system may have evolved specific functions in Brucella that differ from homologous systems in other bacteria. The search results indicate that sn-glycerol-3-phosphate transported via ugp can be used as a phosphate source but not as a carbon source under certain conditions , suggesting complex metabolic integration.

  • Statistical Rigor: Apply appropriate statistical methods to determine if apparent contradictions are statistically significant or within experimental variation.

By applying this systematic approach, researchers can resolve apparent contradictions and develop a more nuanced understanding of ugpA function in different contexts.

What bioinformatic approaches can help characterize ugpA and predict its functional properties?

For characterizing ugpA and predicting its functional properties, researchers should implement these bioinformatic approaches:

  • Sequence Alignment and Phylogenetic Analysis:

    • Perform multiple sequence alignment of ugpA homologs across Brucella species and other bacteria

    • Construct phylogenetic trees to understand evolutionary relationships and functional divergence

    • Identify conserved domains that likely correspond to essential functional regions

  • Structural Prediction:

    • Use protein structure prediction algorithms (AlphaFold2, RoseTTAFold) to generate 3D models of ugpA

    • Predict transmembrane topology using specialized tools (TMHMM, Phobius, TOPCONS)

    • Identify potential substrate-binding pockets and channel-forming regions

  • Functional Domain Analysis:

    • Search for conserved protein domains using databases like Pfam, InterPro, and CDD

    • Identify motifs associated with substrate specificity in transport proteins

    • Analyze sequence for post-translational modification sites that may regulate activity

  • Protein-Protein Interaction Prediction:

    • Use co-evolution analysis to predict residues involved in protein-protein interactions

    • Apply docking simulations to model interactions with other components of the transport system

    • Search for conserved interaction interfaces present in related transport systems

  • Genomic Context Analysis:

    • Examine the organization of the ugp operon in Brucella abortus and related species

    • Identify regulatory elements in the promoter region that respond to phosphate limitation

    • Perform comparative genomics to understand the conservation of the transport system across species

  • Machine Learning Applications:

    • Develop or apply machine learning models trained on known transporter proteins to predict specific functional aspects of ugpA

    • Use feature importance analysis to identify key sequence elements contributing to function

These computational approaches can provide valuable insights into ugpA function and guide the design of targeted experimental studies to validate predictions.

How does the expression and regulation of ugpA compare between in vitro culture conditions and during host infection?

The expression and regulation of ugpA likely differ significantly between in vitro culture and host infection conditions, requiring specialized approaches to accurately compare:

  • Differential Expression Analysis: RNA-seq data from Brucella cultured in vitro versus recovered from infected cells can reveal changes in ugpA expression levels. This should be analyzed at multiple time points post-infection to capture temporal dynamics.

  • Phosphate-Responsive Regulation: Since the ugp system is induced under phosphate starvation , researchers should compare ugpA expression in:

    • Standard laboratory media (phosphate-rich)

    • Phosphate-limited media (to simulate potential host conditions)

    • Intracellular environment (actual host conditions)

  • Promoter Activity Studies: Reporter constructs (such as ugpA promoter fused to GFP) can monitor regulation in real-time during infection versus in vitro growth.

  • Regulatory Network Integration: ugpA regulation should be examined in the context of:

    • The pho regulon (phosphate regulation system)

    • Stress response pathways activated during infection

    • Virulence factor regulation networks

  • Protein Level Verification: Proteomic approaches should complement transcriptomic data to account for post-transcriptional regulation:

    • Targeted proteomics (SRM/MRM) to quantify ugpA protein levels

    • Phosphoproteomics to identify regulatory phosphorylation events

    • Protein half-life studies to assess stability differences

  • Systematic Data Comparison Table:

ConditionugpA mRNA LevelugpA Protein LevelTransport ActivityRegulatory Factors InvolvedMetabolic Context
Rich media[Low/Med/High][Data][Data][Factors][Context]
Phosphate-limited media[Data][Data][Data][Factors][Context]
Early infection (0-24h)[Data][Data][Data][Factors][Context]
Established infection (>24h)[Data][Data][Data][Factors][Context]
Chronic infection[Data][Data][Data][Factors][Context]
  • Functional Significance Assessment: Beyond expression levels, researchers should determine if ugpA function is essential during specific infection stages by using conditional knockouts or inhibitors targeting the transport system.

This comprehensive approach would provide insights into how host environments specifically modulate ugpA expression and activity, potentially revealing new therapeutic targets or vaccine strategies against Brucella infection.

How can recombinant ugpA be utilized in vaccine development against Brucella abortus?

Recombinant ugpA protein could serve as a valuable component in vaccine development against Brucella abortus, based on several strategic considerations:

  • Subunit Vaccine Component: Recombinant ugpA could be included in combined subunit vaccines (CSVs) similar to other Brucella outer membrane proteins. Research has shown that CSVs using multiple recombinant proteins confer higher immune responses than single subunit vaccines . For example, a combination of four recombinant proteins (Omp16, Omp19, Omp28, and L7/L12) demonstrated protective efficacy against Brucella infection .

  • Immunological Profiling: Before inclusion in vaccine formulations, researchers should characterize the immune response to recombinant ugpA by:

    • Assessing antibody responses (IgG subtypes, particularly IgG2a which indicates Th1 responses)

    • Measuring T cell responses (CD4+ and CD8+ proliferation)

    • Evaluating cytokine profiles (IFN-γ, TNF-α, IL-6, and MCP-1 for Th1; IL-10 for Th2)

  • Adjuvant Selection: Optimize adjuvant combinations to enhance the protective immune response:

    • Adjuvants that promote Th1-biased responses are preferable, as Brucella is an intracellular pathogen

    • The IgG2a/IgG1 ratio should be monitored as a marker of Th1/Th2 balance

  • Delivery Systems Development:

    • Explore nanoparticle encapsulation to enhance stability and immunogenicity

    • Investigate mucosal delivery systems to target relevant immune tissues

  • Efficacy Testing Protocol:

    • In vitro: Assess protection in macrophage infection models (e.g., RAW 264.7 cells)

    • In vivo: Evaluate protection in murine models using standardized challenge protocols

    • Measure bacterial clearance, splenomegaly reduction, and cellular immune responses

  • Combination Strategy Table:

Vaccine CompositionImmune Response TypeProtection LevelAdvantagesLimitations
ugpA alone[Data][Data][Points][Points]
ugpA + other OMPs[Data][Data][Points][Points]
ugpA + OMPs + ribosomal proteins[Data][Data][Points][Points]
DNA vaccine encoding ugpA[Data][Data][Points][Points]
Prime-boost (DNA + protein)[Data][Data][Points][Points]

This approach would systematically evaluate ugpA's potential as a vaccine component, potentially contributing to the development of safe and effective vaccines against brucellosis, addressing the current lack of safe and effective vaccines for humans .

What experimental approaches can determine if ugpA is essential for Brucella survival under different environmental conditions?

To determine if ugpA is essential for Brucella survival under various environmental conditions, researchers should implement these experimental approaches:

  • Conditional Gene Inactivation System:

    • Develop inducible/repressible promoter systems to control ugpA expression

    • Create depletion strains where ugpA can be gradually reduced to assess threshold requirements

    • Implement CRISPR interference (CRISPRi) for tunable repression of ugpA expression

  • Environmental Challenge Matrix:

    • Test ugpA-deficient strains against a comprehensive panel of conditions:

Environmental ConditionWild Type SurvivalugpA Mutant SurvivalComplemented Strain SurvivalEssentiality Assessment
Nutrient-rich media[Data][Data][Data][Essential/Non-essential]
Phosphate limitation[Data][Data][Data][Assessment]
Carbon limitation[Data][Data][Data][Assessment]
Acidic pH (phagosome-like)[Data][Data][Data][Assessment]
Oxidative stress[Data][Data][Data][Assessment]
Nitrosative stress[Data][Data][Data][Assessment]
Macrophage infection[Data][Data][Data][Assessment]
Animal infection model[Data][Data][Data][Assessment]
  • High-Resolution Growth Curve Analysis:

    • Implement continuous monitoring systems (like microplate readers) to detect subtle growth defects

    • Analyze growth parameters (lag phase, doubling time, maximum density) quantitatively

    • Perform competition assays between wild-type and ugpA mutants to detect fitness costs

  • Metabolic Bypass Assessment:

    • Identify potential alternative pathways for G3P acquisition or utilization

    • Create double/triple mutants blocking multiple pathways to reveal redundancy

    • Supplement growth media with metabolites that could bypass ugpA function

  • In vivo Fitness Measurements:

    • Use signature-tagged mutagenesis approaches to track multiple strains simultaneously

    • Implement in vivo expression technology (IVET) to monitor ugpA expression during infection

    • Recover bacteria from different tissues/timepoints to assess selection against ugpA mutants

  • Synthetic Lethality Screening:

    • Create libraries of secondary mutations in the ugpA mutant background

    • Identify genetic interactions that become essential only when ugpA is absent

    • Map the network of genes functionally connected to ugpA

These approaches would provide a comprehensive assessment of ugpA essentiality across diverse conditions, revealing not just whether it is essential, but under what specific circumstances it becomes critical for Brucella survival, potentially identifying new therapeutic targets.

How can researchers design experiments to study the interaction between host immune responses and recombinant ugpA protein?

To investigate interactions between host immune responses and recombinant ugpA protein, researchers should implement these experimental designs:

  • Innate Immune Response Characterization:

    • Macrophage Activation Studies: Expose RAW 264.7 cells or primary macrophages to purified recombinant ugpA and measure:

      • Cytokine production (TNF-α, IL-6, IL-12, IL-10)

      • Nitric oxide production as a bactericidal mechanism

      • Cell surface activation markers (CD80, CD86, MHC II)

    • Dendritic Cell Maturation Assays: Analyze dendritic cell responses to ugpA exposure:

      • Maturation markers (CD83, CD86, MHC II)

      • Cytokine secretion profiles

      • Antigen presentation capacity

  • Adaptive Immune Response Analysis:

    • T Cell Response Characterization:

      • Measure proliferation of CD4+ and CD8+ T cells in response to ugpA

      • Analyze T cell polarization (Th1 vs Th2) through cytokine profiling (IFN-γ vs IL-4/IL-10)

      • Identify immunodominant T cell epitopes within ugpA

    • B Cell and Antibody Studies:

      • Characterize antibody isotypes (IgG1, IgG2a, IgM) in response to ugpA immunization

      • Map B cell epitopes using peptide arrays or phage display

      • Assess functional activity of anti-ugpA antibodies (opsonization, neutralization)

  • Experimental Design Table for In Vivo Studies:

Experimental GroupImmunization ProtocolImmune Parameters MeasuredChallenge ProtocolProtection Assessment
Control (adjuvant only)[Protocol]Cytokines, Antibodies, T cell responsesVirulent B. abortusBacterial burden, Splenomegaly
ugpA protein[Protocol][Parameters][Protocol][Assessment metrics]
ugpA + other OMPs[Protocol][Parameters][Protocol][Assessment metrics]
Prime-boost regimen[Protocol][Parameters][Protocol][Assessment metrics]
  • Immunomodulatory Effects Assessment:

    • Investigate whether ugpA possesses immunomodulatory properties:

      • Effect on MHC expression and antigen presentation

      • Impact on pattern recognition receptor signaling

      • Influence on autophagy and phagolysosomal fusion

  • Cross-Presentation Studies:

    • Examine how ugpA is processed and presented to CD8+ T cells:

      • Use DCs and macrophages to assess cross-presentation efficiency

      • Identify processing pathways involved (proteasomal vs. non-proteasomal)

  • Advanced Flow Cytometry Analysis:

    • Implement multi-parameter flow cytometry to simultaneously assess:

      • Cell surface markers

      • Intracellular cytokines

      • Transcription factors (T-bet, GATA-3)

      • Proliferation markers

These experimental approaches would comprehensively characterize how recombinant ugpA interacts with the host immune system, providing insights for vaccine development and understanding Brucella pathogenesis. Evidence from similar studies with other Brucella proteins suggests that recombinant proteins can elicit strong pro-inflammatory cytokine responses and drive predominantly Th1-type immunity, which is crucial for protection against intracellular pathogens like Brucella .

What are the most promising future research directions for understanding ugpA's role in Brucella pathogenesis?

The most promising future research directions for understanding ugpA's role in Brucella pathogenesis include:

  • Systems Biology Integration: Apply multi-omics approaches (transcriptomics, proteomics, metabolomics) to understand how ugpA functions within the broader network of Brucella virulence factors. This would reveal potential synergistic interactions with other virulence determinants and identify regulatory networks controlling ugpA expression during infection.

  • Host-Pathogen Interface Mapping: Investigate whether ugpA directly interacts with host cell components using proximity labeling techniques (BioID, APEX) in infected cells. This could reveal unexpected roles beyond nutrient acquisition, such as potential involvement in modulating host cell signaling or membrane trafficking.

  • Structure-Function Relationship Elucidation: Determine the three-dimensional structure of ugpA using advanced structural biology techniques, then correlate structural features with specific functions through targeted mutagenesis. This would provide atomic-level insights into transport mechanisms and potential druggable sites.

  • Temporal Dynamics of Expression: Implement single-cell approaches to understand the heterogeneity and timing of ugpA expression during different stages of infection, potentially revealing subpopulations of bacteria with distinct metabolic states or virulence potential.

  • Comparative Analysis Across Brucella Species: Conduct comprehensive comparative studies of ugpA function across multiple Brucella species and biovars to understand how transport system variations contribute to host specificity and virulence differences. This could reveal adaptations specific to B. abortus biovar 1 that contribute to its pathogenesis.

  • Novel Therapeutic Targeting: Explore ugpA as a potential therapeutic target by developing small molecule inhibitors of the transport system, potentially creating new antimicrobials with specific activity against Brucella.

These research directions would collectively advance our understanding of ugpA's multifaceted roles in Brucella pathogenesis and potentially lead to novel intervention strategies against brucellosis.

What are the key methodological challenges researchers should anticipate when working with recombinant ugpA and how can they be addressed?

Researchers working with recombinant ugpA should anticipate several methodological challenges and implement these strategic solutions:

  • Membrane Protein Expression Challenges:

    • Challenge: Low expression yields and protein misfolding

    • Solutions:

      • Use specialized expression strains designed for membrane proteins

      • Optimize induction conditions (lower temperature, reduced inducer concentration)

      • Consider fusion partners that enhance folding and solubility

      • Explore cell-free expression systems supplemented with lipids or nanodiscs

  • Protein Solubility and Stability Issues:

    • Challenge: Maintaining native structure during solubilization and purification

    • Solutions:

      • Screen multiple detergents or use newer solubilization methods like SMALPs

      • Include stabilizing ligands or binding partners during purification

      • Implement thermal stability assays to identify optimal buffer conditions

      • Consider nanobody-assisted stabilization of specific conformations

  • Functional Assay Development:

    • Challenge: Establishing assays that accurately measure transport activity

    • Solutions:

      • Reconstitute purified protein in liposomes for transport assays

      • Develop fluorescent or radioactive substrate analogs for sensitive detection

      • Use complementation of transport-deficient bacterial strains as functional readouts

      • Implement electrophysiological methods to measure transport directly

  • Immunogenicity Assessment:

    • Challenge: Ensuring recombinant protein maintains native epitopes

    • Solutions:

      • Validate proper folding using conformation-specific antibodies

      • Compare immunoreactivity with Brucella-positive sera to native protein

      • Use circular dichroism or other spectroscopic methods to verify secondary structure

      • Perform epitope mapping to ensure critical antigenic regions are preserved

  • Biosafety Considerations:

    • Challenge: Working with proteins from Category B bioterrorism agents

    • Solutions:

      • Develop surrogate systems using non-pathogenic bacteria expressing Brucella ugpA

      • Implement proper containment measures according to institutional guidelines

      • Consider synthetic biology approaches to study specific domains rather than full protein

      • Use computational models to guide experiments, minimizing hands-on work with pathogen-derived materials

By anticipating these challenges and implementing appropriate methodological solutions, researchers can overcome the technical difficulties associated with recombinant ugpA studies and generate more reliable and meaningful data.

How might understanding ugpA function contribute to broader knowledge of bacterial transport systems and pathogenesis?

Understanding ugpA function in Brucella abortus has significant implications for broader knowledge in several key areas:

  • Evolution of Specialized Transport Systems: Comparative analysis of ugpA across species can reveal how transport systems evolve specialized functions in different bacterial niches. The ugp system in Brucella shows unique characteristics, such as its ability to support growth using G3P as a phosphate source but not as a carbon source under certain conditions , suggesting evolutionary adaptations specific to the intracellular lifestyle of Brucella.

  • Bacterial Metabolic Adaptation: The regulation of ugpA under phosphate limitation exemplifies how pathogens rewire their metabolism to adapt to nutrient-restricted host environments. This provides insights into broader principles of metabolic flexibility that enable pathogen survival within hosts.

  • Transport-Virulence Connections: Understanding how nutrient acquisition systems like ugpA contribute to pathogenesis bridges the gap between bacterial metabolism and virulence. This knowledge challenges the traditional separation between "housekeeping" and "virulence" functions, recognizing that metabolic systems are integral to pathogenesis.

  • Novel Antimicrobial Strategies: Characterizing ugpA function could reveal vulnerabilities in bacterial nutrient acquisition that could be exploited for new antimicrobial approaches. Transport proteins represent underexplored targets for antimicrobial development, particularly for intracellular pathogens where traditional antibiotics have limited access.

  • Vaccine Design Principles: The potential use of ugpA in subunit vaccines contributes to our understanding of how membrane proteins can be effectively utilized as vaccine antigens. This knowledge can inform rational vaccine design for other pathogens with similar transport systems.

  • Host-Pathogen Interaction Dynamics: Understanding how transport systems like ugpA function during infection provides insights into the complex metabolic dialogue between host and pathogen, revealing how pathogens compete with host cells for essential nutrients.

  • Structural Basis of Membrane Transport: Detailed structural and functional studies of ugpA would contribute to the broader understanding of membrane transport mechanisms, particularly for binding protein-dependent transport systems that are widespread across many bacterial species .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.