Recombinant Brucella abortus biovar 1 Type IV secretion system protein virB10 (virB10)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Brucella abortus VirB10 Protein

The Recombinant Brucella abortus biovar 1 Type IV secretion system protein VirB10 (VirB10) is a component of the Type IV secretion system (T4SS) in Brucella abortus, a bacterium that causes brucellosis . The T4SS is crucial for the virulence of Brucella, enabling it to infect host cells and establish a replicative niche . VirB10, as a protein complex, plays a vital role in the T4SS, which translocates effector proteins into host cells to modulate their function .

The Type IV Secretion System (T4SS)

The T4SS is a complex nanomachine essential for the pathogenesis of Brucella spp . It is encoded by the virB operon, which consists of 11 genes (virB1 to virB11) and two putative genes (orf12 or virB12 and orf13) . The T4SS is responsible for translocating effector proteins into the host cell, which helps the bacterium to evade the host's immune response and establish a secure niche for replication .

Function of VirB10 in Brucella abortus

VirB10 is essential for the stability and function of the T4SS. Mutant strains of Brucella abortus lacking a functional virB10 gene are capable of short-term survival inside macrophages, but they cannot evade long-term degradation through fusion with lysosomes . Studies have shown that VirB10 is required for Brucella to evade fusion with lysosomes and establish a replicative niche within macrophages .

Role of VirB10 in Immune Response and Vaccine Development

VirB proteins, including VirB10, have the potential for vaccine development and serological diagnosis of brucellosis . Several studies have indicated that VirB10 can induce immune responses when combined with other proteins to create recombinant vaccines .

VirB10 and Autophagy

Brucella abortus induces autophagy in hepatic stellate cells in a VirB-dependent manner . When hepatic stellate cells are infected with a virB10 mutant, the levels of certain proteins associated with autophagy do not significantly differ from those of uninfected cells, indicating that a functional T4SS is required for the activation of the autophagy signaling pathway .

VirB10 and Copper-Zinc Superoxide Dismutase (Cu-Zn SOD)

Cu-Zn SOD is a VirB-independent effector in Brucella abortus . Studies have shown that the release of Cu-Zn SOD into the culture supernatant of B. abortus is independent of the VirB T4SS .

VirB10 in Diagnostics

VirB10 has potential value for serological diagnosis of brucellosis . Research has focused on individual VirB proteins, but there is a lack of systematic analysis on the use of VirB proteins for serological diagnosis of brucellosis . Further research could explore VirB proteins as diagnostic antigens for human brucellosis .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes; we will accommodate your request if possible.
Lead Time
Delivery times vary depending on shipping method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
virB10; BruAb2_0060; Type IV secretion system protein virB10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-388
Protein Length
full length protein
Species
Brucella abortus biovar 1 (strain 9-941)
Target Names
virB10
Target Protein Sequence
MTQENIPVQPGTLDGERGLPTVNENGSGRTRKVLLFLFVVGFIVVLLLLLVFHMRGNAEN NHHSDKTMVQTSTVPMRTFKLPPPPPPAPPEPPAPPPAPAMPIAEPAAAALSLPPLPDDT PAKDDVLDKSASALMVVTKSSGDTNAQTAGDTVVQTTNARIQALLDSQKNTKQDAGSLGT LLHGTQTDARMASLLRNRDFLLAKGSIINCALQTRLDSTVPGMAACVVTRNMYSDNGKVL LIERGSTISGEYDANVKQGMARIYVLWTRVKTPNGVVIDLDSPGADPLGGAGLPGYIDSH FWKRFGGALMLSTIETLGRYATQKVGGGGSNQINLNTGGGESTSNLASTALKDTINIPPT LYKNQGEEIGIYIARDLDFSSVYDVKPK
Uniprot No.

Target Background

Database Links
Protein Families
TrbI/VirB10 family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the virB10 protein in Brucella abortus?

The virB10 protein is an integral component of the Type IV secretion system in Brucella abortus. It is encoded within the virB operon, which consists of at least 11 genes (virB1 to virB11) arranged in a collinear fashion. The protein consists of 388 amino acids and functions as part of the multiprotein complex that spans the bacterial cell envelope, forming a channel for the translocation of effector molecules into host cells. Mutational studies have demonstrated that virB10 is specifically necessary for the proper function of the T4SS apparatus, as different mutations in this gene produce distinct phenotypes in experimental infection models . The protein's structure contains domains for membrane integration and protein-protein interactions that are essential for assembling a functional secretion apparatus.

How is the virB operon organized in Brucella abortus?

The Brucella abortus virB locus represents a collinear arrangement of 13 open reading frames (ORFs), including the core virB1 through virB11 genes, plus two additional genes designated orf12 (also referred to as virB12) and orf13. Between virB1 and virB2 and downstream of orf12, researchers have identified degenerated palindromic repeat sequences that are characteristic of Brucella intergenic regions. These genomic features may play regulatory roles in operon expression. Gene reporter studies have confirmed that the B. abortus virB locus constitutes an operon transcribed from virB1, with expression predominantly occurring during the stationary phase of bacterial growth . This temporal regulation suggests that T4SS assembly and function are tightly controlled during the bacterial life cycle, likely in response to specific environmental cues encountered during infection.

What is the role of the Type IV secretion system in Brucella pathogenesis?

The Type IV secretion system encoded by the virB operon represents a major virulence determinant in Brucella abortus. Experimental evidence demonstrates that B. abortus mutants with a polar mutation in virB1 fail to replicate in HeLa cells, indicating the T4SS is critical for intracellular multiplication . The secretion system is thought to deliver effector molecules that modify the intracellular trafficking pathway of the bacteria-containing vacuole, redirecting it to an endoplasmic reticulum-related compartment where replication can occur. This ability to establish a replicative niche while evading lysosomal degradation is fundamental to Brucella's intracellular lifestyle. Mouse infection assays have conclusively shown that the virB operon constitutes a major determinant of B. abortus virulence, as mutants deficient in functional T4SS components show significant attenuation in persistence models . The conservation of this secretion system across pathogenic Brucella species underscores its evolutionary importance in the genus' adaptation to intracellular survival.

How do mutations in virB10 affect Brucella abortus virulence and intracellular replication?

Research with both polar and nonpolar mutations in virB10 has revealed distinct phenotypic outcomes in experimental infection models, providing insights into the protein's specific contributions to T4SS function. Studies demonstrate that mutants with different types of virB10 mutations exhibit variable behaviors in mice and HeLa cell infection assays . These differential outcomes strongly suggest that virB10 itself, rather than just its presence within the operon structure, is necessary for proper T4SS functionality. The protein likely contributes to the structural integrity of the secretion apparatus, potentially forming part of the channel structure that spans the bacterial envelope. Researchers investigating virB10 should employ precise genetic approaches that distinguish between effects caused by loss of the entire operon function versus specific defects in virB10 structure or interactions. Complementation studies with wild-type and mutant virB10 variants can further elucidate the structure-function relationships that determine virulence outcomes in different experimental models.

What is the relationship between virB10 expression and the intracellular trafficking of Brucella abortus?

The expression of virB10 as part of the T4SS appears to be mechanistically linked to the unique intracellular trafficking pathway that allows Brucella abortus to establish its replicative niche. Evidence suggests that the secretion system delivers effector molecules that modify host cell vesicular transport machinery, resulting in the redirection of the bacteria-containing vacuole to an endoplasmic reticulum-derived compartment . This specialized intracellular compartment provides protection from lysosomal degradation while supplying nutrients necessary for bacterial replication. The temporal expression pattern of the virB operon, which is upregulated during stationary phase growth, suggests that the T4SS is assembled and functional when bacteria transition from initial invasion to establishing their replicative niche. To fully understand virB10's contribution to this process, researchers must employ advanced cellular and molecular techniques including high-resolution imaging of infected cells, identification of secreted effectors, and characterization of host factors that interact with the T4SS or its substrates during different stages of intracellular infection.

How does the structure of virB10 contribute to T4SS function in Brucella compared to other bacterial pathogens?

The full-length virB10 protein in Brucella abortus comprises 388 amino acids with a specific sequence that contributes to T4SS assembly and function. The complete amino acid sequence (MTQENIPVQPGTLDGERGLPTVNENGSGRTRKVLLFLFVVGFIVVLLLLLVFHMRGNAENNHHSDKTMVQTSTVPMRTFKLPPPPPPAPPEPPAPPPAPAMPIAEPAAAALSLPPLPDDTPAKDDVLDKSASALMVVTKSSGDTNAQTAGDTVVQTTNARIQALLDSQKNTKQDAGSLGTLLHGTQTDARMASLLRNRDFLLAKGSIINCALQTRLDSTVPGMAACVVTRNMYSDNGKVLLIERGSTISGEYDANVKQGMARIYVLWTRVKTPNGVVIDLDSPGADPLGGAGLPGYIDSHFWKRFGGALMLSTIETLGRYATQKVGGGGSNQINLNTGGGESTSNLASTALKDTINIPPTLYKNQGEEIGIYIARDLDFSSVYDVKPK) contains domains important for membrane integration, protein-protein interactions, and possibly substrate recognition . Comparative analysis with T4SS components in other bacterial pathogens reveals both conserved functional domains and species-specific adaptations. While the core function of forming part of a trans-envelope secretion channel appears conserved, the specific substrates translocated and regulatory mechanisms may differ significantly between Brucella and other T4SS-containing bacteria such as Agrobacterium tumefaciens or Legionella pneumophila. These differences likely reflect adaptation to different host environments and pathogenic strategies. Detailed structural studies using approaches such as X-ray crystallography and cryo-electron microscopy are needed to fully elucidate how Brucella virB10's structure enables its specific functions within the assembled T4SS complex.

What are the optimal conditions for expressing and purifying recombinant virB10 protein?

For optimal expression and purification of recombinant Brucella abortus virB10 protein, researchers should implement a systematic approach beginning with appropriate vector design. The full-length gene encoding amino acids 1-388 should be amplified from B. abortus genomic DNA using high-fidelity PCR and cloned into an expression vector incorporating an N-terminal His-tag to facilitate purification . E. coli expression systems (particularly BL21 strains) have proven effective for virB10 production . Optimization of expression conditions should include induction with IPTG at OD600 0.6-0.8, followed by extended cultivation at reduced temperatures (16-25°C) to enhance soluble protein yield and minimize inclusion body formation. Purification can be achieved through a multi-step process beginning with affinity chromatography using Ni-NTA resin, followed by size exclusion chromatography if higher purity is required. The final product should be stored in Tris/PBS-based buffer containing 6% trehalose at pH 8.0 . For long-term storage, researchers should either lyophilize the protein or add glycerol (5-50% final concentration) and store as aliquots at -20°C/-80°C to prevent degradation from repeated freeze-thaw cycles . Quality control should confirm >90% purity by SDS-PAGE analysis .

How can researchers effectively study the interaction between virB10 and other components of the T4SS?

To comprehensively investigate interactions between virB10 and other T4SS components, researchers should employ multiple complementary methodologies that provide insights at different levels of molecular detail. Co-immunoprecipitation experiments using antibodies against tagged versions of virB10 can identify interaction partners within the assembled complex. For more targeted analyses, bacterial two-hybrid systems offer a genetic approach to validate direct protein-protein interactions by expressing virB10 and candidate partners as fusion proteins with complementary reporter fragments. Biophysical techniques including surface plasmon resonance (SPR) and isothermal titration calorimetry (ITC) with purified components can provide quantitative binding parameters, while chemical crosslinking combined with mass spectrometry can map specific interaction interfaces within the assembled complex. For structural visualization, single-particle cryo-electron microscopy has emerged as a powerful approach to resolve the architecture of assembled multi-protein complexes like the T4SS. Functional validation of identified interactions should involve site-directed mutagenesis targeting specific residues, followed by phenotypic characterization in relevant infection models. This multi-faceted approach provides both structural and functional insights into how virB10 contributes to T4SS assembly and activity during Brucella infection.

What are the recommended approaches for studying virB10 expression during Brucella infection?

To accurately characterize virB10 expression during Brucella infection, researchers should implement a multi-level analysis approach that captures transcriptional, translational, and post-translational regulation. At the transcriptional level, quantitative RT-PCR using primers specific for virB10 and appropriate reference genes can measure relative transcript abundance at different infection timepoints. This approach has confirmed that the virB operon is activated during the stationary phase of growth . For real-time monitoring during infection, fluorescent reporter fusions (transcriptional or translational) provide spatial and temporal information about virB10 expression within individual bacteria. At the protein level, specific antibodies against virB10 enable detection by Western blotting and immunofluorescence microscopy, revealing both expression levels and subcellular localization during infection. Serological evidence from infected mice indicates that virB proteins are expressed in vivo and are immunogenic , validating their production during actual infection. For more advanced analyses, ribosome profiling or proteomics approaches can provide genome-wide context for virB10 expression relative to other bacterial genes during different infection stages. These complementary methodologies collectively provide a comprehensive understanding of when, where, and how virB10 is expressed during the Brucella infection cycle.

How can recombinant virB10 protein be used to develop diagnostic tools for brucellosis?

Recombinant virB10 protein has significant potential as a diagnostic antigen for brucellosis detection based on evidence that this protein is expressed during infection and elicits detectable antibody responses. Studies in mice infected with B. abortus have demonstrated the immunogenicity of virB proteins , suggesting their utility in serological diagnostics. To develop effective virB10-based diagnostic tools, researchers should first optimize the production of highly purified recombinant protein with preserved antigenic epitopes, potentially using the His-tagged expression systems that have been successfully implemented . The purified protein can then be evaluated in enzyme-linked immunosorbent assays (ELISAs) using well-characterized serum panels from confirmed brucellosis cases and appropriate controls. Diagnostic performance parameters including sensitivity, specificity, and cross-reactivity with antibodies against related pathogens must be rigorously established. To enhance diagnostic accuracy, researchers should consider multiplex approaches combining virB10 with other immunodominant Brucella antigens. Validation studies should include diverse patient populations from endemic regions and comparison with gold standard diagnostic methods. The established immunogenicity of virB10 during natural infection provides a strong foundation for its development as a component of next-generation brucellosis diagnostics, potentially offering advantages in sensitivity or specificity compared to currently available tests.

What is the current understanding of virB10's role in Brucella vaccine development research?

The critical role of virB10 in Brucella virulence mechanisms positions this protein as a significant target in vaccine development strategies against brucellosis. Current research demonstrates that the virB operon constitutes a major determinant of B. abortus virulence , suggesting that targeted modifications of virB10 could generate rationally attenuated vaccine strains. Studies comparing different mutations in virB10 have revealed distinct behaviors in experimental models , providing insights that could guide the development of strains with optimal attenuation profiles - sufficiently reduced in virulence to ensure safety while retaining immunogenicity. Beyond live attenuated approaches, purified recombinant virB10 protein could serve as a component in subunit vaccine formulations, potentially eliciting protective immune responses when combined with appropriate adjuvants. The conservation of the virB operon across pathogenic Brucella species suggests that virB10-based vaccine strategies might confer cross-protection against multiple Brucella species. To advance this research direction, investigators should thoroughly characterize both humoral and cell-mediated immune responses to virB10, identify protective epitopes within the protein structure, and evaluate protection in relevant animal models. These fundamental immunological studies provide the scientific foundation necessary for translational vaccine development.

How does virB10 contribute to host-pathogen interactions during Brucella infection?

The virB10 protein, as an integral component of the T4SS, plays multiple roles in mediating host-pathogen interactions during Brucella infection. Fundamentally, it contributes to the structural integrity of the secretion apparatus that delivers bacterial effector molecules into host cells . These translocated effectors likely modulate various host cell processes to create a permissive environment for bacterial replication. Research has demonstrated that a functional T4SS is essential for directing Brucella to its replicative niche, an endoplasmic reticulum-derived compartment that supports bacterial multiplication . This intracellular trafficking ability represents a sophisticated evolutionary adaptation that allows Brucella to avoid lysosomal degradation while accessing nutrients needed for growth. The temporal expression pattern of the virB operon, which is upregulated during stationary phase , suggests that the T4SS functions during specific stages of the infection cycle, likely corresponding to the transition from initial invasion to establishment of the replicative niche. To comprehensively understand virB10's contributions to host-pathogen interactions, researchers must identify the specific effector molecules translocated by the T4SS, characterize their biochemical activities within host cells, and determine how these activities collectively shape the intracellular environment to favor bacterial persistence.

What are the structural and functional domains of the virB10 protein?

The virB10 protein of Brucella abortus comprises 388 amino acids organized into distinct structural and functional domains that enable its role within the T4SS complex. Based on sequence analysis and comparison with homologous proteins in other bacterial systems, several key domains can be identified. The N-terminal region likely contains cytoplasmic elements involved in interactions with other T4SS components, followed by a transmembrane domain that anchors the protein in the bacterial inner membrane. The substantial periplasmic portion forms part of the secretion channel structure and contributes to substrate recognition. Analysis of the complete amino acid sequence (MTQENIPVQPGTLDGERGLPTVNENGSGRTRKVLLFLFVVGFIVVLLLLLVFHMRGNAENNHHSDKTMVQTSTVPMRTFKLPPPPPPAPPEPPAPPPAPAMPIAEPAAAALSLPPLPDDTPAKDDVLDKSASALMVVTKSSGDTNAQTAGDTVVQTTNARIQALLDSQKNTKQDAGSLGTLLHGTQTDARMASLLRNRDFLLAKGSIINCALQTRLDSTVPGMAACVVTRNMYSDNGKVLLIERGSTISGEYDANVKQGMARIYVLWTRVKTPNGVVIDLDSPGADPLGGAGLPGYIDSHFWKRFGGALMLSTIETLGRYATQKVGGGGSNQINLNTGGGESTSNLASTALKDTINIPPTLYKNQGEEIGIYIARDLDFSSVYDVKPK) reveals notable features including a proline-rich region that may provide structural flexibility and mediate protein-protein interactions. The C-terminal domain likely participates in outer membrane association and may contribute to channel gating functions. Mutational studies examining different regions of virB10 have demonstrated that the protein's integrity is necessary for proper T4SS function , confirming that these structural domains contribute collectively to virB10's essential role in the secretion apparatus.

What are the optimal storage and handling conditions for recombinant virB10 protein preparations?

Optimal storage and handling of recombinant Brucella abortus virB10 protein are critical for maintaining structural integrity and functional properties for research applications. Based on experimental data, the recommended conditions include storage as a lyophilized powder for maximum stability during long-term storage . When reconstitution is necessary, researchers should use deionized sterile water to prepare solutions at concentrations between 0.1-1.0 mg/mL . For buffer composition, a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 has been shown to maintain protein stability . Long-term storage should utilize temperatures between -20°C and -80°C, with addition of glycerol (5-50% final concentration) to prevent freeze-induced denaturation . Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be strictly avoided as they significantly compromise protein integrity . Before use, brief centrifugation is recommended to bring contents to the bottom of the storage container . Quality control should include SDS-PAGE analysis to confirm that protein purity remains above 90% . These conditions have been empirically determined to preserve the native structure and functionality of recombinant virB10 preparations, ensuring reproducible results in downstream applications such as structural studies, interaction assays, or immunological experiments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.