Recombinant Brucella abortus biovar 1 Type IV secretion system protein virB3 (virB3)

Shipped with Ice Packs
In Stock

Description

Role in Type IV Secretion System

The VirB3 protein is encoded by the virB3 gene, which is part of the virB locus containing 12 open reading frames (virB1 through virB12) that collectively encode components of the Type IV secretion system in Brucella abortus . This secretion apparatus is crucial for the pathogen's ability to evade host immune responses and establish persistent infection.

The T4SS functions as a molecular machine that spans the bacterial cell envelope and serves to transport macromolecules, including effector proteins, across membranes into host cells. This transport mechanism enables the bacterium to modulate host cell functions and establish a replication-permissive niche within the host . VirB3 is an integral component of this complex machinery, contributing to both the structural integrity and functional capacity of the secretion apparatus.

Interaction with Other VirB Proteins

Research findings indicate that VirB3 interacts closely with other components of the T4SS, particularly VirB4, VirB5, VirB8, VirB9, VirB10, and VirB11. Studies reveal that deletion of the virB3 gene leads to reduced levels of these proteins, suggesting that VirB3 plays a critical role in the stability and assembly of the T4SS complex . Specifically, when virB3 is deleted, levels of VirB5, VirB8, VirB9, VirB10, and VirB11 are significantly reduced, suggesting either an effect of the mutation on translation or a requirement of the VirB3 protein for stability of other T4SS proteins .

Function in Brucella Pathogenesis

VirB3, as a component of the T4SS, plays a pivotal role in the intracellular lifecycle of Brucella abortus. Following invasion of host cells, Brucella resides initially in endosomal-derived vacuoles (eBCVs), which must be remodeled into replication-permissive organelles (rBCVs) derived from the host endoplasmic reticulum . This transformation requires the delivery of effector proteins via the T4SS, allowing the bacterium to manipulate host secretory functions and establish a replicative niche.

Intracellular Survival and Replication

Studies with deletion mutants have provided valuable insights into the significance of VirB3 for Brucella pathogenesis. Mutants lacking virB3 demonstrate a markedly reduced ability to survive in J774A.1 mouse macrophage-like cells, comparable to the defect observed with deletion of the entire virB locus . This finding underscores the essential nature of VirB3 for intracellular survival and replication of Brucella abortus.

The persistence of Brucella within host cells is a multi-stage process, with the T4SS playing roles beyond the initial establishment of the replicative niche. Following replication, rBCVs are converted into autophagic vacuoles (aBCVs) that facilitate bacterial egress and subsequent infections . While VirB-deficient mutants are stalled in eBCVs and cannot mediate rBCV biogenesis, functionally controlled T4SS studies suggest that this secretion system also drives subsequent stages of the Brucella intracellular cycle, potentially involving VirB3 in these later processes as well .

Research Findings on VirB3 Deletion Mutants

Experimental studies using nonpolar deletion mutants have provided compelling evidence for the essential nature of VirB3 in Brucella virulence. Deletion of the virB3 gene significantly reduces the ability of Brucella abortus to survive in cultured macrophages and to persist in the organs of mice, particularly the spleen, at eight weeks post-infection .

Comparative Analysis with Other VirB Deletions

Comprehensive studies examining the effects of deleting various virB genes have revealed that virB3 belongs to a group of essential virB genes that includes virB2, virB4, virB5, virB6, virB8, virB9, virB10, and virB11 . Interestingly, while virB1, virB7, and virB12 show varying degrees of dispensability for Brucella virulence in mice, virB3 is absolutely required for both intracellular survival in macrophages and persistence in mouse organs .

The differential requirements for various VirB proteins in Brucella pathogenesis highlight the complex nature of the T4SS assembly and function. The essential nature of VirB3 suggests its involvement in core structural or functional aspects of the secretion apparatus that cannot be compensated by other components.

Production and Purification of Recombinant VirB3

The recombinant production of VirB3 protein provides researchers with a valuable tool for investigating its structure, function, and potential applications. The protein is typically expressed in Escherichia coli with an N-terminal histidine tag to facilitate purification using affinity chromatography .

Reconstitution and Handling

For research applications, proper reconstitution of the lyophilized protein is crucial. The recommended procedure involves brief centrifugation to bring the contents to the bottom of the vial, followed by reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL . Addition of glycerol (5-50% final concentration) is recommended for long-term storage, with aliquoting and storage at -20°C to -80°C to maintain protein integrity .

Table 2: Reconstitution Protocol for Recombinant VirB3

StepProcedure
1Briefly centrifuge vial before opening
2Reconstitute in deionized sterile water (0.1-1.0 mg/mL)
3Add glycerol (5-50% final concentration)
4Aliquot for long-term storage
5Store at -20°C to -80°C

Genomic Context and Comparative Analysis

Recent comparative genomic analyses of Brucella strains have provided additional context for understanding the conservation and variation of virB genes, including virB3, across different isolates. Studies involving multiple Brucella abortus and Brucella melitensis strains from Egypt have revealed insights into the genetic stability of virulence factors across geographical isolates .

These comparative genomic approaches have identified single nucleotide polymorphisms (SNPs) along the genomes of various Brucella strains, with 338 SNPs identified across eight Brucella abortus strains . Such variations could potentially affect the structure and function of virulence factors, including components of the T4SS like VirB3, though specific impacts on this protein were not detailed in the available research.

The genomic analysis also highlights the importance of considering strain variations when studying virulence factors and designing potential countermeasures against brucellosis. The relationship between vaccine strains (such as RB51 for Brucella abortus) and field isolates provides valuable context for understanding the evolution and adaptation of virulence mechanisms .

Immunological Aspects and Vaccine Potential

While the search results do not provide specific information about immune responses to VirB3, research on other Brucella proteins suggests potential implications for vaccine development. Studies on Brucella abortus proteins have demonstrated that recombinant plasmids based on certain open reading frames can induce Th1-type immune responses, correlated with heightened resistance to Brucella abortus infection in mice .

Product Specs

Form
Lyophilized powder
Note: While we preferentially ship the format we have in stock, we are happy to accommodate specific format requirements. Please indicate your preferred format when placing your order, and we will fulfill it to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipment, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize fulfilling your specified tag preference.
Synonyms
virB3; BruAb2_0067; Type IV secretion system protein virB3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-116
Protein Length
full length protein
Species
Brucella abortus biovar 1 (strain 9-941)
Target Names
virB3
Target Protein Sequence
MTTAPQESNARSAGYRGDPIFKGCTRPAMLFGVPVIPLVIVGGSIVLLSVWISMFILPLI VPIVLVMRQITQTDDQMFRLLGLKAQFRLIHFNRTGRFWRASAYSPIAFTKRKRES
Uniprot No.

Target Background

Database Links
Protein Families
VirB3 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the membrane topology of VirB3 in Brucella abortus?

VirB3 is a small inner membrane protein (108 amino acids) with a distinctive topology. Experimental evidence using PhoA and green fluorescent protein (GFP) as periplasmic and cytoplasmic reporters respectively demonstrates that VirB3 contains two membrane-spanning domains with both N and C termini residing in the cytoplasm . Earlier studies incorrectly classified VirB3 as an outer membrane protein, but biochemical fractionation studies have conclusively shown that VirB3 proteins encoded by three different Ti plasmids (pTiA6NC, pTiBo542, and pTiC58) all localize to the inner membrane . This membrane localization is crucial for its function within the T4SS complex.

How does VirB3 contribute to the virulence of Brucella abortus?

VirB3 plays an essential role in B. abortus virulence through its contribution to the Type IV secretion system. Deletion studies using nonpolar mutations demonstrate that virB3 is crucial for bacterial survival in J774A.1 mouse macrophage-like cells . Additionally, deletion of virB3 markedly reduces the ability of B. abortus to persist in the spleens of mice at 8 weeks post-infection, similar to the effects observed with deletions of virB4, virB5, virB6, virB8, virB9, virB10, and virB11 . The protein's precise mechanism within the secretion apparatus likely involves facilitating the assembly or structural integrity of the T4SS complex that translocates effector molecules into host cells.

Which VirB proteins are essential for the stability of VirB3?

The stability of VirB3 depends on multiple protein interactions within the T4SS complex. Research demonstrates that VirB4 is necessary but not sufficient for VirB3 stabilization. For the octopine Ti plasmid pTiA6NC VirB3, two additional proteins—VirB7 and VirB8—are required for effective stabilization . This tripartite requirement (VirB4/VirB7/VirB8) suggests that VirB3 functions within a tightly integrated multiprotein complex where protein-protein interactions are critical for maintaining structural integrity. Interestingly, a simple binary interaction between VirB3 and any single protein (VirB4, VirB7, or VirB8) is insufficient for VirB3 stabilization , highlighting the complex interdependencies within the T4SS assembly.

What are effective approaches for creating nonpolar deletions of virB3?

Constructing nonpolar deletions of virB3 requires a meticulous two-step process to avoid affecting expression of downstream genes in the virB operon. Based on methodologies described in the literature, this approach typically involves:

  • Amplification of 1-kb upstream and downstream fragments of the virB3 gene using PCR

  • Cloning these fragments into a vector such as pCR2.1 TOPO

  • Ligating the upstream and downstream fragments together in the vector

  • Introducing this construct into Brucella abortus

  • Selecting for integration using appropriate antibiotics (e.g., carbenicillin)

  • Counter-selection using sucrose to identify colonies where the second recombination event has occurred

  • Confirming deletion through restriction digestion of genomic DNA and Southern blot analysis

This methodology ensures that only the virB3 gene is deleted without disrupting the expression of other virB genes, which is critical for accurately determining VirB3's specific functions.

How can researchers effectively create and analyze VirB3 fusion proteins?

Creating fusion proteins with VirB3 requires careful design to maintain protein functionality while incorporating reporter tags. Based on successful approaches documented in the literature, researchers should consider:

  • Construction of virB3-phoA fusions:

    • Amplify the desired region of virB3 along with an appropriate promoter (e.g., virDp)

    • Clone as a restriction fragment (e.g., BamHI-PstI) into a phoA fusion vector

    • Transfer to a wide-host-range vector for expression in Agrobacterium or Brucella

  • Creation of GFP fusions:

    • Construct a vector containing GFP with unique restriction sites for N or C-terminal fusions

    • Amplify virB3 coding region without the stop codon for C-terminal fusions

    • Clone into appropriate sites in the GFP vector

    • Transfer to a wide-host-range vector with a constitutive promoter for expression

Analysis of these fusion proteins can involve fluorescence microscopy to determine subcellular localization, biochemical fractionation to confirm membrane association, and functional complementation studies to verify activity.

What methods can detect interactions between VirB3 and other T4SS components?

Detecting protein-protein interactions involving VirB3 requires specialized approaches due to its membrane localization. Effective methodologies include:

MethodApplicationAdvantagesLimitations
Co-immunoprecipitationDetecting native protein complexesPreserves physiological interactionsRequires specific antibodies
Bacterial two-hybridScreening potential interactionsHigh-throughput capabilityMay miss membrane protein interactions
Chemical cross-linkingCapturing transient interactionsIdentifies proximity in vivoMay cause artifacts
FRET/BRETDetecting interactions in living cellsReal-time analysis possibleRequires fluorescent/luminescent tags
Co-purificationIsolating stable complexesCan identify multiple componentsMay disrupt weak interactions

When applying these methods to VirB3, researchers should pay particular attention to maintaining the membrane environment during extraction and analysis, as detergent selection can significantly affect the detection of membrane protein interactions.

How does the membrane topology of VirB3 influence its function in the Type IV secretion system?

The unique membrane topology of VirB3, with two transmembrane domains and both termini in the cytoplasm, plays a critical role in its T4SS function. This configuration creates a loop region that extends into the periplasmic space, potentially facilitating interactions with other T4SS components spanning the cell envelope . The cytoplasmic localization of both N and C termini may enable interactions with cytoplasmic components of the secretion apparatus, such as the ATPase VirB4.

The small periplasmic domain of VirB3 is likely functionally significant, as evidenced by the fact that previous studies failed to obtain PhoA-positive insertions in this region despite successfully obtaining such insertions in other small VirB proteins . This suggests that the periplasmic domain has structural constraints that make it incompatible with large insertions, possibly due to critical interactions with other T4SS components in this compartment.

What is the relationship between VirB3 and VirB4, and how does it affect T4SS assembly?

The relationship between VirB3 and VirB4 represents a critical aspect of T4SS assembly and function. Research demonstrates that:

  • VirB4 is essential for VirB3 stability, suggesting a direct or indirect interaction between these proteins

  • Despite this stabilizing effect, VirB4 does not influence the membrane localization of VirB3, indicating that VirB3 independently targets to the inner membrane

  • The stabilization of VirB3 requires not only VirB4 but also VirB7 and VirB8, suggesting a complex interaction network rather than a simple binary relationship

The VirB3-VirB4 relationship may represent a crucial checkpoint in T4SS assembly, where successful interaction between these components permits progression to subsequent assembly steps. The large, energetically active VirB4 component might recognize correctly positioned VirB3 as part of a quality control mechanism during T4SS biogenesis.

How does VirB3 contribute to T-pilus formation in the Type IV secretion system?

VirB3 is required for the assembly of the T-pilus, an extracellular appendage of the T4SS that facilitates contact with target cells . Evidence suggests that VirB3's contribution to T-pilus formation involves:

  • Potential interactions with the VirB2 pilin, which also localizes to the inner membrane before incorporation into the pilus structure

  • Creation of a nucleation point or scaffold for pilus assembly through its membrane-embedded domains

  • Facilitation of pilin processing or transport through the cell envelope during pilus biogenesis

The localization of both VirB3 and the VirB2 pilin to the bacterial cell pole suggests a coordinated spatial organization of T4SS components during assembly . This polarized localization may establish a specialized zone for efficient T-pilus formation and subsequent secretion functions.

Why does VirB7 deletion affect macrophage survival but not virulence in mice?

One of the most intriguing contradictions in the VirB research field concerns the role of VirB7. Unlike other VirB proteins (including VirB3), deletion of virB7 reduces the ability of B. abortus to survive in J774A.1 mouse macrophage-like cells but does not affect the bacteria's ability to persist in the spleens of mice . This discrepancy suggests several possible explanations that warrant further investigation:

  • VirB7 may be specifically required for survival in certain cell types (macrophages) but dispensable in others encountered during mouse infection

  • Alternative proteins might compensate for VirB7's function in vivo but not in isolated macrophage cultures

  • The mouse infection model may not fully recapitulate the cellular environments where VirB7 is critical

Resolving this contradiction requires comparative proteomics of T4SS complexes in different cellular environments and more detailed analysis of tissue-specific bacterial survival during infection.

How do we reconcile contradictory findings about VirB3's membrane localization?

Earlier studies reported that pTiC58-encoded VirB3 localizes to the bacterial outer membrane, while more recent research demonstrates that VirB3 is an inner membrane protein . This contradiction highlights several methodological considerations:

  • Differences in fractionation techniques might affect membrane protein distribution

  • VirB3 might relocate between membrane compartments under specific conditions

  • The source of VirB3 (different Ti plasmids) might influence its localization properties

To resolve this contradiction, researchers should conduct comparative analyses using consistent fractionation methods across different VirB3 sources, perhaps employing multiple complementary techniques such as density gradient centrifugation, fluorescence microscopy of GFP fusions, and antibody-based localization methods.

What novel approaches could elucidate the structure-function relationship of VirB3?

Future research into VirB3's structure-function relationship could benefit from several emerging methodologies:

  • Cryo-electron microscopy: Applying cryo-EM to purified T4SS complexes containing VirB3 could reveal its precise position and structural contributions to the secretion apparatus

  • Cross-linking mass spectrometry: This approach could identify specific contact points between VirB3 and other T4SS components

  • Site-directed mutagenesis: Systematic mutation of conserved residues in VirB3's transmembrane domains and termini could identify critical functional regions

  • Single-molecule tracking: Using photoactivatable fluorescent proteins fused to VirB3 could reveal dynamic aspects of its behavior during T4SS assembly

These approaches would provide complementary insights into how this small but essential protein contributes to T4SS architecture and function.

How might VirB3 serve as a target for novel antimicrobial strategies?

Given VirB3's essential role in Brucella virulence, it represents a promising target for antimicrobial development. Several approaches warrant exploration:

  • Small molecule inhibitors: Compounds that disrupt VirB3's interaction with VirB4, VirB7, or VirB8 could destabilize the protein and compromise T4SS function

  • Peptidomimetics: Designed peptides that mimic critical regions of VirB3 could competitively inhibit its incorporation into the T4SS complex

  • PROTAC approach: Proteolysis-targeting chimeras could selectively degrade VirB3, eliminating it from the bacterial cell

Such strategies could potentially circumvent conventional antibiotic resistance mechanisms by targeting virulence rather than viability, reducing selective pressure while effectively preventing disease.

Could comparative analysis of VirB3 across Brucella species reveal host-adaptation mechanisms?

The VirB3 protein and broader T4SS show variations across Brucella species that may reflect adaptation to different hosts. A systematic comparative analysis could:

  • Identify species-specific sequence variations in VirB3 that correlate with host range

  • Determine whether regulatory differences in virB3 expression exist between zoonotic and non-zoonotic Brucella species

  • Test VirB3 protein complementation between species to identify functional differences

This approach could leverage model systems such as the recently described B. neotomae BALB/c infection model, which offers a promising alternative to working with select agent Brucella strains while recapitulating key attributes of zoonotic infection .

What are the advantages of using B. neotomae as a model system for studying VirB3 function?

The use of B. neotomae as a research model offers significant advantages for studying VirB3 and the T4SS:

  • B. neotomae is not classified as a select agent, eliminating the need for biosafety level 3 containment required for work with other Brucella species

  • The cell biology and T4SS dependence of B. neotomae intracellular replication mirror those of human-pathogenic Brucella species

  • In the BALB/c mouse model, B. neotomae demonstrates similar infectious course and pathologies to zoonotic Brucella species, including T4SS-dependent:

    • Efficient early infection of liver, spleen, and lymph nodes

    • Granuloma formation and hepatosplenomegaly

    • Early induction of Th1-associated cytokine gene expression

These similarities make B. neotomae an excellent surrogate for studying the fundamental biology of VirB3 and other T4SS components without the regulatory and safety burdens associated with select agent research.

What methodological approaches can help resolve contradictory findings in VirB3 research?

When confronting contradictory findings in VirB3 research, such as discrepancies in membrane localization or functional requirements, researchers should consider implementing:

  • Standardized experimental protocols: Establishing consistent methods for membrane fractionation, protein detection, and virulence assessment

  • Multi-method validation: Confirming key findings using complementary approaches (e.g., biochemical fractionation plus microscopy)

  • Meta-analysis techniques: Applying computational methods similar to those used for detecting contradictory drug efficacy claims to systematically identify patterns in conflicting VirB3 literature

  • Open science practices: Sharing detailed protocols, raw data, and reagents to enable direct replication by other laboratories

By implementing these methodological approaches, researchers can help resolve contradictions and build a more coherent understanding of VirB3 biology across different experimental systems and Brucella species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.