Recombinant Brucella abortus biovar 1 UPF0283 membrane protein BruAb1_1038 (BruAb1_1038)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
BruAb1_1038; UPF0283 membrane protein BruAb1_1038
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-357
Protein Length
full length protein
Species
Brucella abortus biovar 1 (strain 9-941)
Target Names
BruAb1_1038
Target Protein Sequence
MSDKTPRKPTAFRLEQPARVSAASEQEEPRRPRAVKDLEQITPQADVFDLTDDEAAELEI LDPAFEAPERKGWSLSRILFGALGILVSFAIGIWTEDLIRALFARADWLGWTALGVAMVA LAAFAAIILRELVALRRLASVQHLRKDAADAAERDDMAAARKAVDALRTIAAGIPETAKG RQLLDSLTDDIIDGRDLIRLAETEILRPLDREARTLVLNASKRVSIVTAISPRALVDIGY VIFESTRLIRRLSQLYGGRPGTLGFIKFARRVIAHLAVTGTIAMGDSVIQQLVGHGLASR LSAKLGEGVVNGLMTARIGIAAMDVVRPFPFNAEKRPGIGDFIGDLARLNSDRNARK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for producing recombinant BruAb1_1038?

E. coli expression systems remain the most widely used for BruAb1_1038 production, particularly with His-tag modifications to facilitate purification . The protein can be expressed as a full-length construct (1-357 amino acids), though researchers should consider the following optimization strategies:

  • Using bacterial strains optimized for membrane protein expression (C41(DE3), C43(DE3))

  • Employing low-temperature induction (16-20°C) to enhance proper folding

  • Incorporating solubility-enhancing fusion partners (MBP, SUMO) for improved yield

  • Testing various detergents for optimal solubilization during purification

For structural studies requiring higher purity, insect cell or mammalian expression systems may provide better results, though with increased complexity and cost .

What are the typical yields of purified BruAb1_1038 protein from expression systems?

Typical yields vary significantly based on expression conditions and purification methods:

Expression SystemAverage Yield (mg/L culture)Purity LevelMain Challenges
E. coli (standard)0.5-2.085-90%Inclusion body formation
E. coli (optimized)3.0-5.090-95%Detergent optimization
Insect cells1.0-3.0>95%Higher cost, complexity
Mammalian cells0.5-1.5>98%Longest production time

Optimization steps typically focus on induction timing, temperature, and detergent selection during membrane protein extraction .

How should researchers design experiments to study BruAb1_1038 membrane localization?

Robust experimental design for studying BruAb1_1038 localization requires multiple complementary approaches:

  • Fluorescence microscopy using GFP-tagged constructs to visualize cellular distribution

  • Subcellular fractionation followed by Western blotting with anti-His antibodies

  • Protease accessibility assays to determine topology within the membrane

  • Immunogold electron microscopy for precise localization at the ultrastructural level

A true experimental design should include proper controls and randomization of samples . For instance:

  • Positive controls: Known membrane proteins with similar predicted topology

  • Negative controls: Cytoplasmic proteins and extracellular markers

  • Technical replicates: Minimum of 3 per condition

  • Biological replicates: Different bacterial cultures processed independently

Statistical analysis should employ ANOVA with post-hoc tests to determine significance of localization patterns between experimental groups .

What are the best approaches for studying protein-protein interactions involving BruAb1_1038?

To investigate protein-protein interactions involving BruAb1_1038, consider these methodological approaches:

  • Co-immunoprecipitation (Co-IP) using anti-His antibodies, followed by mass spectrometry to identify interacting partners

  • Bacterial two-hybrid systems adapted for membrane proteins

  • Proximity labeling techniques (BioID, APEX) to identify neighbors in the membrane environment

  • Surface plasmon resonance (SPR) for quantitative binding studies with purified components

When designing these experiments, researchers should consider:

  • The potential disruption of interactions by detergents during membrane solubilization

  • The possibility of indirect interactions via bridging proteins

  • The need for crosslinking approaches to capture transient interactions

  • The importance of validating interactions through multiple independent methods

Quasi-experimental designs may be necessary when studying interactions in their native context, where complete randomization is not possible .

What are the most effective detergents and lipids for crystallization or cryo-EM studies of BruAb1_1038?

Selecting appropriate detergents and lipids is critical for structural studies of BruAb1_1038. Based on studies of similar membrane proteins, we recommend:

MethodRecommended DetergentsRecommended LipidsSpecial Considerations
X-ray CrystallographyDDM, DM, OGDMPC, DOPCAdd specific lipids during purification
Cryo-EMLMNG, GDNNanodiscs with POPC/POPE mixturesConsider adding cholesterol for stability
NMRDPC, DHPCBicelles with DMPC/DHPCDeuterated detergents for better spectra

For cryo-EM studies specifically, following the methodology used for other multi-pass membrane proteins like those in Rhodobacter sphaeroides has shown promise . The protocol should include:

  • Initial extraction with 1% (w/v) DDM

  • Detergent exchange to 0.01% LMNG during purification

  • Final sample preparation in nanodiscs using MSP1D1 scaffold protein

  • Grid preparation with thin carbon support films to prevent preferential orientation

This approach has yielded high-resolution structures (2.9-3.5Å) for similar membrane proteins .

What experimental designs are most appropriate for studying BruAb1_1038 function in Brucella abortus?

Given that BruAb1_1038 is a membrane protein with unknown function, a multi-faceted experimental approach is recommended:

  • Gene deletion studies: Create knockout strains using CRISPR-Cas9 or homologous recombination, then assess phenotypic changes in:

    • Growth rates under various conditions

    • Membrane integrity and permeability

    • Virulence in cell infection models

    • Stress responses (pH, temperature, oxidative stress)

  • Complementation experiments: Reintroduce wild-type or mutated BruAb1_1038 to confirm phenotypes are directly related to the protein

  • Reporter fusion studies: Create translational fusions with reporters like luciferase to monitor expression under different conditions

A true experimental design should include:

  • Multiple biological replicates (n≥5)

  • Technical replicates for each measurement

  • Appropriate statistical analysis (ANOVA with post-hoc tests)

  • Controls for potential polar effects in genetic manipulations

For quasi-experimental approaches when full randomization isn't possible, consider time-series designs with multiple baseline measurements .

How can researchers differentiate between direct and indirect effects when studying BruAb1_1038 function?

Differentiating direct from indirect effects requires careful experimental design and controls:

  • Site-directed mutagenesis of key residues predicted to be functional, rather than complete gene deletion

  • Temporal analysis of effects after protein induction or depletion

  • Dose-dependent studies with regulated expression systems

  • Direct biochemical assays with purified components

When designing these experiments, consider:

  • Using inducible promoters to control expression levels

  • Creating point mutations rather than truncations

  • Employing rapid induction/depletion systems

  • Including parallel studies of potential interaction partners

Statistical approaches such as mediation analysis can help determine whether observed effects are direct or mediated through other factors .

How should researchers approach contradictory results from different structural prediction methods for BruAb1_1038?

When facing contradictory predictions for BruAb1_1038 structure, implement this systematic approach:

  • Quantify the discrepancies between different methods:

    • Calculate RMSD between structural models

    • Identify specific regions of disagreement

    • Compare confidence scores for disputed regions

  • Weight predictions based on:

    • Method validation statistics for membrane proteins

    • Depth and diversity of the sequence alignments used

    • Agreement with experimental data (if available)

  • Validate through orthogonal approaches:

    • Perform secondary structure analysis (CD spectroscopy)

    • Use cysteine scanning mutagenesis to probe accessibility

    • Design experiments to test model-specific predictions

  • Create ensemble models that represent the range of possible structures

Decision matrix for resolving structural prediction conflicts:

ScenarioAlphaFold2 pLDDTESMFold pLDDTResolution Strategy
High confidence in both, structures differ>80>80Design experiments to distinguish models
High confidence in one model>80<70Prioritize high-confidence model, validate experimentally
Low confidence in both<70<70Collect experimental data before proceeding

This systematic approach has successfully resolved contradictions in other membrane protein studies, particularly for regions with ambiguous topology .

What statistical approaches are most appropriate for analyzing BruAb1_1038 expression under different experimental conditions?

For analyzing BruAb1_1038 expression data:

  • For parametric data (normally distributed):

    • Two conditions: Student's t-test (paired or unpaired)

    • Multiple conditions: One-way ANOVA with appropriate post-hoc tests (Tukey's or Bonferroni)

    • Multiple factors: Two-way ANOVA with interaction analysis

  • For non-parametric data:

    • Two conditions: Mann-Whitney U test or Wilcoxon signed-rank test

    • Multiple conditions: Kruskal-Wallis test followed by Dunn's multiple comparison

  • For time-course experiments:

    • Repeated measures ANOVA

    • Mixed-effects models for incomplete datasets

  • For complex experimental designs:

    • Consider MANOVA for multiple dependent variables

    • Use hierarchical modeling for nested experimental designs

Sample size determination should be based on power analysis, typically aiming for 80% power with α=0.05. For expression studies with anticipated moderate effect sizes (Cohen's d=0.5), a minimum of 12-15 biological replicates per condition is recommended .

How can researchers evaluate the potential of BruAb1_1038 as a vaccine candidate?

Evaluating BruAb1_1038 as a vaccine candidate requires a comprehensive experimental approach:

  • Epitope prediction and analysis:

    • In silico prediction of B-cell and T-cell epitopes

    • Peptide synthesis and binding assays

    • Evaluation of epitope conservation across Brucella strains

  • Immunogenicity studies:

    • Recombinant protein production and purification

    • Antibody response measurement (titer, isotype, avidity)

    • T-cell response analysis (proliferation, cytokine production)

  • Protection studies in animal models:

    • Immunization with various formulations and adjuvants

    • Challenge with virulent Brucella strains

    • Quantification of bacterial load in tissues

    • Histopathological examination

  • Comparative studies:

    • Side-by-side comparison with established vaccine candidates

    • Combination approaches with other antigens

The experimental design should follow these principles:

  • Randomized allocation of animals to treatment groups

  • Appropriate sample size based on power analysis

  • Blinded assessment of outcomes

  • Multiple readouts of protection (bacterial load, pathology, immune response)

What are the best approaches for studying the role of BruAb1_1038 in Brucella abortus pathogenesis?

To investigate BruAb1_1038's role in pathogenesis:

  • Cellular infection models:

    • Macrophage infection assays with wild-type and BruAb1_1038-deficient strains

    • Quantification of bacterial entry, survival, and replication

    • Analysis of host cell responses (cytokine production, cell death)

  • Animal infection models:

    • Mouse model for systemic infection

    • Pregnant ruminant models for reproductive pathology

    • Tracking bacterial dissemination using reporter strains

  • Mechanistic studies:

    • Protein-protein interaction studies with host factors

    • Influence on bacterial stress resistance

    • Impact on cell envelope properties

  • Comparative genomics:

    • Sequence conservation analysis across Brucella species

    • Correlation with host specificity and virulence

When designing these experiments, consider:

  • Including multiple time points to capture dynamic processes

  • Using multiple readouts for each experiment

  • Complementing genetic studies with biochemical approaches

  • Implementing systems biology approaches when possible

What emerging technologies hold promise for advancing BruAb1_1038 research?

Several cutting-edge technologies are poised to transform BruAb1_1038 research:

  • Cryo-electron tomography for visualizing the protein in its native membrane environment

  • Single-particle cryo-EM with improved detectors and phase plates for high-resolution structure determination

  • AlphaFold-Multimer and similar tools for predicting protein-protein interactions

  • Native mass spectrometry for analyzing membrane protein complexes

  • CRISPR interference (CRISPRi) for fine-tuned gene expression modulation

  • Single-cell techniques for studying heterogeneity in bacterial populations

Implementing these approaches will require careful experimental design and validation against established methods. Researchers should consider collaborative approaches to access specialized equipment and expertise .

How can researchers design experiments to resolve conflicting data about BruAb1_1038 function?

When facing conflicting data about BruAb1_1038 function:

  • Systematically identify potential sources of variability:

    • Different bacterial strains or growth conditions

    • Variations in experimental protocols

    • Different measurement techniques

    • Statistical power limitations

  • Design reconciliation experiments:

    • Side-by-side comparisons under identical conditions

    • Incremental protocol modifications to identify critical variables

    • Independent validation in different laboratories

    • Meta-analysis of all available data

  • Implement robust experimental design principles:

    • Pre-registration of experimental protocols

    • Blinded analysis where possible

    • Consistent statistical approaches

    • Reporting of all data, including negative results

  • Consider alternative hypotheses:

    • Multifunctional protein with context-dependent activities

    • Strain-specific functions

    • Indirect effects through other cellular components

This systematic approach has successfully resolved contradictions in other challenging membrane protein studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.