Recombinant Brucella abortus Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Biochemical and Functional Characterization

  • Enzymatic Activity: PlsY transfers acyl groups from acyl-phosphate to glycerol-3-phosphate, forming lysophosphatidic acid (LPA) . This reaction is rate-limiting in phospholipid biosynthesis, critical for membrane integrity in Brucella .

  • Substrate Specificity: Prefers C16:0 and C18:1 acyl chains, as shown in S. pneumoniae homologs .

  • Mutational Analysis: Alanine substitutions in conserved motifs (e.g., Gly→Ala in motif 2) impair substrate binding, confirming their catalytic roles .

Table 2: Functional Properties of Recombinant PlsY

PropertyDetail
Optimal pH7.5–8.0 (Tris/PBS buffer)
Kinetic Parameters (Km)0.5 mM for glycerol-3-phosphate (mutant studies)
InhibitorsPalmitoyl-CoA (noncompetitive, IC50 ~10 µM)
Thermal StabilityStable at 4°C for 1 week; long-term storage requires -80°C

Role in Brucella Pathogenicity

PlsY is implicated in Brucella abortus virulence through:

  1. Membrane Biogenesis: Essential for synthesizing phospholipids, ensuring bacterial survival in host macrophages .

  2. Stress Adaptation: Co-regulated with virulence genes (e.g., virB) under acidic, nutrient-limited conditions mimicking intracellular niches .

  3. Vaccine Development: Recombinant PlsY is evaluated in subunit vaccines (e.g., fused with Omp10/Omp28/L7/L12), showing enhanced Th1 immune responses in murine models .

Research Applications

  • Vaccine Antigens: Fused with outer membrane proteins (e.g., Omp10-Omp28-L7/L12) to improve immunogenicity .

  • Enzyme Inhibition Studies: Used to screen antimicrobials targeting lipid biosynthesis .

  • Structural Biology: Crystallization efforts to resolve acyltransferase mechanisms .

Future Directions

  • Genetic Silencing: plsY knockout strains could elucidate its role in Brucella persistence .

  • Therapeutic Targeting: Inhibitors of PlsY may disrupt bacterial membrane synthesis, offering novel antimicrobial strategies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate special requirements. Please specify your desired format during order placement, and we will fulfill your request whenever possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery details.
Note: Our standard shipping includes normal blue ice packs. If dry ice is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type is decided during production. If you have a preference for a particular tag, please inform us, and we will prioritize its inclusion in the development process.
Synonyms
plsY; BAbS19_II05970; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Brucella abortus (strain S19)
Target Names
plsY
Target Protein Sequence
MAEPGFFNAMLIGALIFGYVLGSIPFGLILTRLAGLGDVRAIGSGNIGATNVLRTGNKKL AAATLILDALKGTAAALIAAHFGQNAAIAAGFGAFIGHLFPVWIGFKGGKGVATYLGVLI GLAWAGALVFAAAWIVTALLTRYSSPSALVASLIVPIALYSRGNQALAALFAIMTVIVFI KHRANISRLLNGTESKIGAKG
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). Acyl-phosphate serves as the fatty acyl donor for this enzyme, but it does not utilize acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of Glycerol-3-phosphate acyltransferase (plsY) in Brucella abortus?

Glycerol-3-phosphate acyltransferase (plsY) in Brucella abortus plays a critical role in phospholipid biosynthesis, specifically in the initial acylation step of membrane phospholipid production. The enzyme catalyzes the transfer of an acyl group from acyl-acyl carrier protein (acyl-ACP) to the sn-1 position of glycerol-3-phosphate, forming lysophosphatidic acid. This reaction represents the first committed step in the biosynthesis of membrane phospholipids, which are essential components of the bacterial cell membrane. The integrity and composition of these membranes are crucial for B. abortus survival within host cells, as they provide both structural support and selective permeability. Additionally, phospholipid composition impacts the bacterium's ability to evade host immune responses and adapt to intracellular environmental stresses, making plsY an enzyme of significant interest in understanding B. abortus pathogenicity.

How can microfluidic technologies enhance the study of recombinant plsY enzyme kinetics?

Microfluidic technologies offer transformative approaches for studying recombinant plsY enzyme kinetics with unprecedented precision and throughput. These platforms dramatically reduce the volume requirements for enzymatic assays, enabling researchers to conduct thousands of experiments simultaneously while consuming minimal reagents. By combining microfluidics with cell-free protein synthesis, as demonstrated in the HT-MEK system, scientists can create microscopic chambers containing different variants of plsY through modified DNA instructions, facilitating systematic structure-function relationship studies . The nanoliter-scale reaction volumes allow for rapid diffusion and mixing, resulting in more uniform reaction conditions and reduced experimental variability compared to traditional flask-based methods. Additionally, microfluidic platforms enable real-time monitoring of reaction kinetics through integrated detection systems, providing dynamic data on substrate binding, product formation, and enzyme stability under various conditions. This high-throughput approach permits comprehensive characterization of how mutations affect plsY catalytic efficiency, substrate specificity, and response to potential inhibitors, accelerating both fundamental understanding of the enzyme and applied research seeking to target plsY function.

What strategies are effective for analyzing the impact of plsY deletion or modification on Brucella abortus metabolism?

Analyzing the impact of plsY deletion or modification on Brucella abortus metabolism requires sophisticated genetic engineering approaches combined with comprehensive metabolic profiling. In-frame deletion mutants can be constructed using PCR overlap techniques similar to those employed for other metabolic genes in B. abortus, where primers are designed to create deletion alleles that maintain the reading frame while removing the functional portions of the gene . For plsY studies, researchers should consider constructing not only knockout mutants but also strains expressing modified versions of the enzyme with altered activity or regulation. Following genetic modification, bacterial growth should be assessed in both rich and defined media to determine the essentiality of plsY under different nutritional conditions. Intracellular survival assays using macrophage cell lines such as J774A.1 provide critical information about the role of plsY in pathogenesis, as demonstrated with other metabolic genes . Metabolomic analysis using techniques such as liquid chromatography-mass spectrometry can identify specific metabolic bottlenecks or alternative pathways activated in response to plsY manipulation. Additionally, transcriptomic profiling via RNA sequencing would reveal compensatory gene expression changes, providing insights into the regulatory networks connected to phospholipid biosynthesis in B. abortus.

How can researchers effectively study the interaction between plsY and the host immune system during Brucella infection?

Studying interactions between plsY and the host immune system during Brucella infection requires multi-faceted approaches that bridge molecular enzymology and immunology. Recombinant strains expressing modified versions of plsY can be evaluated for their ability to modulate immune responses in both cellular and animal models. Infection of murine macrophage-like cell lines (such as J774A.1) with these recombinant strains allows assessment of cytotoxicity, bacterial survival, and host cell apoptosis—parameters that indicate immune system engagement . Flow cytometry analysis provides quantitative data on programmed cell death mechanisms, distinguishing between apoptosis and necrosis in infected cells, as demonstrated with other recombinant B. abortus strains . The production of key cytokines like IFN-γ should be measured in both cell culture supernatants and serum from infected animals, as enhanced Th1 immune responses have been observed with other recombinant strains . In vivo studies using BALB/c mice are essential for understanding the long-term immunological consequences of plsY modification, with bacterial clearance rates serving as indicators of immune system effectiveness. The cross-presentation pathway, whereby bacterial antigens are presented to CD8+ T cells following bacterial endosome escape, merits particular attention as it may be influenced by membrane composition changes resulting from plsY modification.

What purification techniques yield the highest activity for recombinant plsY from Brucella abortus?

Purification of active recombinant plsY from Brucella abortus presents unique challenges due to its membrane-associated nature and requires specialized techniques to maintain structural integrity and enzymatic activity. Initial extraction typically employs detergent solubilization with mild non-ionic detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin, which effectively isolate membrane proteins while preserving their native conformation. Following extraction, affinity chromatography using nickel-nitrilotriacetic acid (Ni-NTA) columns can capture His-tagged recombinant plsY with high specificity, though careful optimization of imidazole gradients is necessary to minimize non-specific binding while maximizing target protein recovery. Size exclusion chromatography serves as an excellent polishing step, separating the target enzyme from aggregates and providing information about its oligomeric state in solution. Throughout the purification process, incorporating glycerol (10-15%) and reducing agents in all buffers helps stabilize the enzyme against denaturation and oxidation. Activity assays should be performed after each purification step to track specific activity and identify conditions that preserve function. For structural studies requiring exceptional purity, additional ion exchange chromatography may be necessary, though researchers must balance the trade-off between purity and activity loss during extended purification procedures.

How can researchers accurately measure the enzymatic activity of plsY in vitro?

Accurate measurement of plsY enzymatic activity in vitro requires carefully designed assays that account for the membrane-associated nature of the enzyme and its specific catalytic requirements. A radiometric assay using 14C-labeled acyl-CoA or acyl-ACP substrates represents the gold standard approach, allowing direct quantification of labeled lysophosphatidic acid product formation through thin-layer chromatography or high-performance liquid chromatography. For higher throughput analysis, a coupled spectrophotometric assay can be employed, where the release of free CoA during the acyltransferase reaction is linked to the reduction of NAD+ to NADH via auxiliary enzymes, allowing continuous monitoring at 340 nm. Alternatively, fluorescence-based assays using labeled substrates or products offer exceptional sensitivity for kinetic studies with limited enzyme quantities. When conducting these assays, researchers must carefully optimize reaction conditions including pH, temperature, ionic strength, and detergent concentration, as these parameters significantly impact plsY activity. Substrate concentration ranges should be determined through preliminary experiments to ensure proper Michaelis-Menten kinetics analysis. Control reactions lacking either enzyme or substrates are essential for establishing background rates, particularly important when working with membrane proteins that may co-purify with lipids that interfere with assay readouts.

What are the key considerations when designing site-directed mutagenesis experiments for studying plsY structure-function relationships?

Designing effective site-directed mutagenesis experiments for studying plsY structure-function relationships requires strategic selection of target residues based on comprehensive preliminary analysis. Researchers should begin by generating a multiple sequence alignment of plsY from diverse bacterial species to identify evolutionary conserved residues likely to be functionally significant. Homology modeling based on crystal structures of related acyltransferases can provide valuable structural context for selecting mutation sites, particularly focusing on predicted active site residues, substrate binding pockets, and potential allosteric regulatory sites. When implementing mutagenesis, it is advisable to create a gradient of mutations ranging from conservative substitutions (maintaining similar physiochemical properties) to non-conservative changes, providing insights into the tolerance of specific positions to modification. The use of microfluidic platforms combined with cell-free protein synthesis offers exceptional advantages for this work, allowing parallel testing of thousands of enzyme variants in nanoliter-sized reaction chambers . Mutations should target not only catalytic residues but also regions potentially involved in membrane association, protein-protein interactions, or conformational changes during catalysis. Following mutagenesis, comprehensive kinetic characterization should assess changes in Km, kcat, and substrate specificity, while stability assays evaluate whether mutations affect protein folding or thermal resistance independent of catalytic function.

How should researchers interpret growth differences between wild-type and plsY-modified Brucella abortus in various media?

Interpreting growth differences between wild-type and plsY-modified Brucella abortus strains across various media requires careful analysis that considers both direct and compensatory metabolic effects. Growth rate variations in complex versus defined media provide crucial insights into the metabolic dependencies created by plsY modification. In rich media containing diverse carbon sources and lipid precursors, plsY mutants may show minimal growth defects due to the availability of alternative metabolic routes or direct uptake of phospholipid precursors that bypass the need for de novo synthesis. Conversely, growth in gluconeogenic media would likely reveal more pronounced deficiencies if plsY modifications impair phospholipid biosynthesis, similar to observations with other metabolic gene knockouts in B. abortus . Researchers should quantify growth parameters including lag phase duration, doubling time, and maximum cell density to comprehensively characterize phenotypic differences. When analyzing these data, it's important to distinguish between direct metabolic consequences of plsY modification and secondary effects resulting from altered membrane composition, which may influence nutrient uptake systems or stress responses. Comparative transcriptomic analysis between wild-type and mutant strains growing in different media can reveal compensatory pathways activated in response to plsY modification, providing deeper mechanistic understanding beyond simple growth curves.

What approaches are most effective for analyzing how plsY affects Brucella abortus virulence in cellular and animal models?

The analysis of plsY's impact on Brucella abortus virulence requires complementary cellular and animal model approaches with quantitative assessment methods. In cellular models, intracellular survival assays using macrophage cell lines provide fundamental virulence data, wherein bacteria are enumerated at various time points post-infection to generate survival curves. Flow cytometry analysis of infected macrophages yields quantitative measurements of programmed cell death mechanisms, distinguishing between apoptosis and necrosis—processes known to be modulated by recombinant B. abortus strains . Confocal microscopy using fluorescently labeled bacteria and intracellular compartment markers enables visualization of trafficking patterns within host cells, revealing whether plsY modification affects the bacterium's ability to reach its replicative niche. In animal models, bacterial burden in target organs (spleen, liver) should be measured at multiple time points to assess colonization efficiency and persistence capabilities, as demonstrated in studies of other B. abortus metabolic mutants that showed attenuated virulence or accelerated clearance in mice . Immunological parameters including serum cytokine profiles (particularly IFN-γ levels), adaptive immune responses, and histopathological changes in infected tissues provide comprehensive virulence data beyond simple bacterial counts. Statistical analysis should employ appropriate models for repeated measures data when tracking infections over time, with careful consideration of biological variability when interpreting results.

What are the future research directions for understanding plsY's role in Brucella abortus pathogenesis?

Future research on plsY's role in Brucella abortus pathogenesis should integrate multiple experimental approaches to develop a comprehensive understanding of this enzyme's significance. Structural biology techniques, including X-ray crystallography and cryo-electron microscopy, will be crucial for determining the three-dimensional architecture of plsY, providing insights into substrate binding mechanisms and identifying potential inhibitor development opportunities. In vivo studies using advanced genetic approaches such as conditional knockdowns or CRISPRi systems would allow temporal control of plsY expression, revealing stage-specific requirements during different phases of infection. Single-cell tracking of bacteria with modified plsY function within host cells using advanced microscopy techniques would uncover how phospholipid biosynthesis influences trafficking to the replicative niche. Systems biology approaches integrating transcriptomics, proteomics, and metabolomics data would reveal how plsY modification ripples through cellular networks, potentially identifying unexpected connections between phospholipid metabolism and virulence factors. Development of small molecule inhibitors specifically targeting B. abortus plsY would provide valuable tools for validating this enzyme as a potential therapeutic target while offering insights into structure-function relationships. Ecological studies examining how plsY activity influences bacterial survival in diverse environmental conditions outside the host would expand our understanding of B. abortus persistence in natural reservoirs. These multidisciplinary approaches will collectively advance our fundamental knowledge while potentially identifying new intervention strategies against brucellosis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.