Recombinant Brucella abortus Immunogenic membrane protein YajC (yajC)

Shipped with Ice Packs
In Stock

Description

Introduction to Brucella abortus and YajC Protein

Brucella abortus is a gram-negative, facultative intracellular bacterium that causes brucellosis, a zoonotic disease affecting both animals and humans. Humans typically acquire brucellosis by consuming contaminated dairy products or through direct contact with infected animal tissues and secretions. While some protection can be achieved in animals through vaccination with attenuated strains, no satisfactory vaccine for humans has been developed to date .

The YajC protein of Brucella abortus was initially identified during screening of a genomic library of B. abortus 2308 for antigens that react with immunoglobulin G2a (IgG2a) antibodies from mice vaccinated with B. abortus RB51, a vaccine strain. This screening strategy was employed to identify Brucella proteins capable of stimulating a T helper 1 (Th1) type immune response, which is considered crucial for protection against intracellular pathogens such as Brucella . The identification of YajC represents a significant finding as it was the first demonstration of this protein's involvement in an immune response to an infectious agent.

Gene Structure and Organization

The yajC gene in B. abortus is organized in an operon structure similar to that found in Escherichia coli, where it is located upstream of the secD gene. Nucleotide sequence analysis of a positive clone (MCB68) from the B. abortus 2308 genomic library revealed two open reading frames (ORFs), with the deduced amino acid sequences showing significant similarities to YajC and SecD proteins of several bacterial species .

A notable feature of the genetic organization is the presence of a potential hairpin loop structure downstream of the yajC gene, which resembles the arrangement in E. coli. While the precise significance of this hairpin structure within an operon remains unclear, it typically functions as a rho-independent transcription terminator when located downstream of genes . The GenBank accession number for the B. abortus yajC gene and partial secD gene sequence is AF085217.

Protein Structure and Putative Function

Based on homology studies with E. coli YajC, the B. abortus YajC protein is believed to be a membrane protein potentially involved in protein secretion and translocation. In E. coli, YajC has been identified as part of the translocation machinery for secretory proteins, working alongside SecD and SecF proteins . Genetic studies with E. coli suggest that YajC is involved in the translocation of secretory proteins across the cytoplasmic membrane.

The functional role of B. abortus YajC protein is hypothesized to be in the translocation of periplasmic or putative secretory proteins. This function may be critical for the bacterium's survival and pathogenicity, particularly considering its intracellular lifestyle . Further deletion mutation studies would help determine the precise role of YajC in the extra- and intracellular survival of B. abortus.

Expression Systems

For immunological studies, the YajC protein of B. abortus has been successfully expressed in E. coli as a fusion protein with maltose binding protein (MBP). This recombinant expression approach allowed for the production of sufficient quantities of the protein for subsequent immunological analyses . The MBP tag not only facilitates purification but may also enhance the solubility of the recombinant protein.

Additionally, for detection of native YajC in B. abortus, the gene has been cloned along with its putative promoter in a broad-host-range vector (pBBR1MCS) and electroporated into B. abortus RB51. This approach resulted in the overexpression of YajC in the strain RB51/pBByajC, which was crucial for demonstrating the presence of the protein in B. abortus .

Detection and Characterization

Western blot analysis has been employed to detect both recombinant and native YajC protein. Interestingly, native YajC could only be detected in B. abortus RB51 when the gene was overexpressed, suggesting that under normal conditions, YajC is expressed at low levels in B. abortus, similar to observations in E. coli . This low-level expression may explain why mice vaccinated with killed B. abortus vaccines do not develop antibodies to YajC.

For immunological studies, YajC has been separated from the purified MBP-YajC fusion protein by factor Xa cleavage, providing purified YajC protein for specific analyses . This purification strategy allows for the examination of immune responses specifically directed against YajC without interference from the MBP fusion partner.

Humoral Immune Response

Western blot analysis has revealed that YajC, but not SecD, reacts with sera from mice vaccinated with B. abortus RB51 . Further tests demonstrated that purified recombinant YajC fusion protein also reacts with sera from mice inoculated with live B. abortus 19, B. abortus 2308, and B. melitensis RM1, indicating that YajC is recognized during infection with various Brucella species and strains .

Notably, sera from mice immunized with killed B. abortus RB51 and B. abortus 19 did not react with the recombinant YajC protein, suggesting that the protein's immunogenicity depends on active infection or vaccination with live attenuated strains . This finding is consistent with the observed low-level expression of YajC in B. abortus, which may be insufficient to trigger an antibody response when the bacteria are administered in a killed form.

Cell-Mediated Immune Response

The recombinant MBP-YajC fusion protein has demonstrated the ability to stimulate splenocytes from B. abortus RB51-vaccinated mice to proliferate in vitro. This proliferation was observed in 3-day cultures but not in 5-day cultures, indicating a specific temporal pattern of cellular response .

More significantly, splenocytes from vaccinated mice produced gamma interferon (IFN-γ) when stimulated with the MBP-YajC fusion protein, while no such response was observed in splenocytes from non-vaccinated control mice . The production of IFN-γ, a Th1 cytokine, is particularly important for protection against intracellular pathogens like Brucella, as it activates macrophages and enhances their ability to kill intracellular bacteria.

Cytokine Production Profile

The cytokine production profile in response to YajC stimulation has been characterized, with results showing significant IFN-γ production but no detectable interleukin-4 (IL-4), a Th2 cytokine . This pattern suggests that YajC primarily induces a Th1-type immune response, which is considered beneficial for protection against brucellosis.

Table 1 presents the concentration of IFN-γ produced by splenocytes from vaccinated and naive mice when stimulated with different antigens:

StimulantConcentration of IFN-γ (ng/ml)
3-day cultures
Vaccinated mice
MediaND
ConA30.55 ± 0.65
RB5129.63 ± 1.00
MBP-YajC0.42 ± 0.10
MBPND

Note: ND = Not Detected. ConA = Concanavalin A (positive control). RB51 = B. abortus RB51 extract .

While the levels of IFN-γ produced in response to MBP-YajC were significantly lower than those induced by the RB51 extract, similar observations have been reported for other recombinant Brucella antigens, including the L7/L12 protein, which has been shown to be involved in stimulating a protective immune response . Therefore, the relatively low levels of IFN-γ production do not necessarily preclude a role for YajC in protective immunity.

Advantages of YajC as a Vaccine Component

The ability of YajC to stimulate both humoral and cell-mediated immune responses, particularly the production of IFN-γ, makes it a promising candidate for inclusion in subunit vaccines against brucellosis. Subunit vaccines, which contain specific components of pathogens rather than whole organisms, offer several advantages, including enhanced safety and the ability to induce targeted immune responses .

Moreover, the conservation of YajC across multiple Brucella species suggests that a YajC-based vaccine might provide cross-protection against different Brucella infections. This broad protective potential would be particularly valuable given the zoonotic nature of brucellosis and the variety of Brucella species capable of causing disease in humans and animals .

Challenges and Considerations

Despite its promising immunological properties, several challenges must be addressed before YajC can be developed into an effective vaccine component. The relatively low-level expression of YajC in Brucella under normal conditions might limit the immune response to the native protein during infection . Additionally, while YajC stimulates IFN-γ production, the levels are lower than those induced by whole-cell extracts, suggesting that YajC alone might not confer complete protection.

Further studies are needed to optimize the presentation of YajC to the immune system, possibly through the use of adjuvants or delivery systems that enhance its immunogenicity. Additionally, protection studies in various animal models would be necessary to evaluate the efficacy of YajC-based vaccines against challenge with virulent Brucella strains .

Structure-Function Studies

Further investigations into the structure and function of YajC would enhance our understanding of its role in Brucella biology and pathogenesis. Deletion mutation studies are being conducted to determine the role of YajC and SecD proteins in the extra- and intracellular survival of B. abortus . Such studies would clarify whether YajC is essential for the bacterium's viability and virulence, information that would be valuable for vaccine development.

Immunization Studies in Various Animal Models

While initial studies have demonstrated the immunogenicity of YajC in mice, further research is needed to evaluate its ability to induce protective immune responses in other animal models, including cattle, pigs, and goats, which are natural hosts for Brucella infections . These studies would provide valuable insights into the potential efficacy of YajC-based vaccines in target species.

Optimization of Vaccine Formulations

Research into optimal vaccine formulations incorporating YajC should be pursued, including the evaluation of different adjuvants, delivery systems, and immunization regimens. Such studies would help maximize the immunogenicity of YajC and enhance its protective efficacy against Brucella infections .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please include any such requests in your order notes, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
yajC; BAB1_0909; Sec translocon accessory complex subunit YajC; Immunogenic membrane protein YajC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-113
Protein Length
full length protein
Species
Brucella abortus (strain 2308)
Target Names
yajC
Target Protein Sequence
MFVTPAFAQASGSVVGPDMLMSILPFILIFVIMYFLIIRPQRTQMKKRQEMLNSVRRGDT VVTGGGIVGKVLKVVDDNELELEIADGVRIRVVRATLMDVRVKGEPVADNKNK
Uniprot No.

Target Background

Function
The SecYEG-SecDF-YajC-YidC holo-translocon (HTL) protein secretase/insertase is a complex essential for protein secretion, membrane protein insertion, and assembly of membrane protein complexes. While the SecYEG complex plays a crucial role in assembling various proteins and complexes, the SecDF-YajC-YidC subcomplex facilitates these functions.
Database Links
Protein Families
YajC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is YajC protein and what is its role in Brucella abortus?

YajC is a membrane protein found in several bacterial species including Brucella abortus. In B. abortus, YajC has been identified as an antigen that potentially stimulates a protective cell-mediated immune response. The protein appears in genomic analysis alongside the SecD protein, with both being encoded by open reading frames (ORFs) identified during screening of a B. abortus 2308 gene library . YajC's primary function relates to membrane protein translocation, where it forms part of integral membrane complexes involved in protein secretion and insertion pathways .

Research demonstrates that YajC is expressed during B. abortus infection and can stimulate both humoral and cell-mediated immune responses in vaccinated mice, making it the first identified case of YajC protein involvement in an immune response to an infectious agent .

How can researchers express and purify recombinant YajC protein for experimental studies?

To express recombinant YajC protein:

  • Cloning approach: The yajC gene can be amplified from B. abortus genomic DNA and cloned into expression vectors such as those in the pMAL series for creation of maltose binding protein (MBP) fusion proteins .

  • Expression system: E. coli is the preferred expression system, with optimal induction parameters typically involving IPTG induction when cultures reach mid-logarithmic phase .

  • Purification protocol:

    • Affinity chromatography using amylose resin for MBP-fusion proteins

    • Ion exchange chromatography followed by size exclusion chromatography

    • Western blot confirmation using sera from mice vaccinated with B. abortus strains can verify protein identity

  • Quality control: SDS-PAGE analysis to confirm purity and immunoblotting to confirm antigenic integrity .

The purified recombinant protein can be used for various immunological assays, including lymphocyte proliferation assays and cytokine production studies .

What immune responses does YajC protein elicit in animal models?

YajC protein has been shown to stimulate both humoral and cell-mediated immune responses in mouse models:

Humoral response:

  • Mice vaccinated with B. abortus RB51, B. abortus 19, B. abortus 2308, or B. melitensis RM1 produce antibodies that recognize YajC in Western blot analyses .

  • IgG2a subisotype antibodies (indicative of a Th1 response) specifically recognize the YajC protein .

Cell-mediated response:

  • Splenocytes from mice vaccinated with B. abortus RB51 show proliferation when stimulated in vitro with recombinant MBP-YajC fusion protein .

  • These splenocytes produce gamma interferon (IFN-γ) but not interleukin-4 (IL-4) upon YajC stimulation, suggesting a Th1-biased immune response .

This Th1-biased response is particularly significant because it is associated with protective immunity against intracellular pathogens like Brucella, which can survive within macrophages of infected animals .

How does YajC compare with other Brucella immunogens in stimulating protective immunity?

YajC represents one of several Brucella antigens identified as potentially protective. Comparative analysis with other Brucella immunogens reveals:

AntigenImmune Response TypeProtective EfficacyDelivery Systems Tested
YajCTh1-biased (IFN-γ production)Under investigationMBP-fusion protein
Cu,Zn SODTh1-biasedDemonstrated protectionRecombinant Ochrobactrum anthropi expressing Cu,Zn SOD
O-polysaccharidePrimarily antibody-mediatedPartial protection in miceVarious vaccine formulations

While the Cu,Zn superoxide dismutase (SOD) of B. abortus has demonstrated protective effects when expressed in the related bacterium Ochrobactrum anthropi (especially when administered with CpG oligonucleotides to enhance Th1 responses) , YajC's protective capacity is still being characterized.

The unique feature of YajC is its dual ability to stimulate antibody production and a Th1-type cellular response, making it a promising candidate for further vaccine development studies .

What is known about the structural characteristics of YajC and its membrane association?

YajC is predicted to be a membrane protein with the following structural characteristics:

  • In E. coli, YajC has been described as part of an integral membrane heterotrimeric complex with SecD and SecF, forming part of the SecYEGDF-YajC system (also called holotranslocon or Sec system) .

  • The protein contains transmembrane domains that anchor it within the bacterial cell membrane.

  • Sequence analysis reveals significant similarities with YajC proteins from several other bacterial species, suggesting evolutionary conservation of this membrane protein .

YajC's membrane localization is critical for its function in protein translocation and insertion pathways. In bacterial systems, it has been shown to interact with multiple membrane protein complexes:

  • The SRP-SecYEG-YajC-YidC1 pathway

  • The SRP-YajC-YidC2 pathway

These pathways are essential for proper insertion of proteins into and across the bacterial membrane, with YajC potentially playing a stabilizing role in these complexes .

How does YajC participate in membrane protein insertion pathways?

YajC participates in membrane protein insertion through two primary pathways as evidenced in studies of various bacterial species:

In E. coli and related systems:

  • YajC forms part of the SecYEGDF-YajC holotranslocon complex .

  • This complex interacts with YidC, an integral membrane protein involved in insertion of proteins into the cytoplasmic membrane .

In Streptococcus mutans and Enterococcus faecium:

  • YajC is part of two cotranslational membrane protein insertion pathways:

    • SRP-SecYEG-YajC-YidC1 pathway

    • SRP-YajC-YidC2 pathway

Functional evidence:

  • Deletion of yajC in E. faecium resulted in increased release of proteins into the supernatant after cell washing, including biofilm-associated proteins .

  • This suggests YajC plays a critical role in:

    • Retaining proteins at the cell surface

    • Ensuring proper docking of proteins to YidC insertases

    • Stabilizing membrane protein complexes involved in protein translocation

These findings indicate that YajC functions not merely as a structural component but as an active participant in membrane biogenesis and protein localization processes essential for bacterial physiology .

What role does YajC play in bacterial biofilm formation and virulence?

Research has demonstrated that YajC contributes significantly to bacterial biofilm formation and virulence, particularly in Enterococcus faecium:

Biofilm formation:

  • Deletion of the yajC gene in E. faecium resulted in significantly impaired biofilm formation in vitro .

  • The yajC mutant showed reduced initial cell adherence to surfaces, a critical first step in biofilm development .

  • This impairment was more pronounced when cells were washed with PBS prior to adhesion assays, suggesting that surface proteins involved in adherence are only loosely attached in the absence of YajC .

Virulence in animal models:

  • In a rat endocarditis model, the E. faecium yajC mutant showed attenuated virulence compared to wild-type strains .

  • Specifically, there was a significant reduction in vegetations on the aortic valve in animals infected with the yajC mutant .

Molecular mechanism:

  • Mass spectrometry analysis of supernatants from washed Δyajc cells revealed increased amounts of cytoplasmic and cell-surface proteins .

  • These included known biofilm-associated proteins such as the tip protein of PilB (also called endocarditis and biofilm associated protein EbpAfm) and the major subunit of PilA .

  • This indicates that YajC is crucial for proper retention of these adhesion-mediating proteins at the cell surface .

While these findings specifically relate to E. faecium, the conservation of YajC across bacterial species suggests similar roles may exist in Brucella and other pathogens, making YajC a potential target for anti-virulence strategies .

How can researchers experimentally assess the impact of YajC on bacterial pathogenesis?

Researchers can employ several experimental approaches to evaluate YajC's role in pathogenesis:

In vitro methods:

  • Gene deletion and complementation studies:

    • Create yajC knockout mutants using homologous recombination or CRISPR-Cas9

    • Complement with wild-type yajC to confirm phenotype specificity

  • Biofilm formation assays:

    • Static biofilm formation on polystyrene plates

    • Flow cell models for dynamic biofilm assessment

    • Crystal violet staining for quantification

  • Initial adherence assays:

    • Compare wild-type and mutant strains with and without washing steps

    • Microscopic visualization of adhered cells

  • Protein localization studies:

    • Mass spectrometry analysis of cell surface proteins and supernatants

    • Compare protein profiles between wild-type and yajC mutants

In vivo methods:

  • Animal infection models:

    • Rat endocarditis model (already validated for YajC studies)

    • Mouse models of brucellosis for Brucella-specific YajC research

  • Immune response evaluation:

    • T-cell proliferation assays

    • Cytokine profiling (particularly IFN-γ/IL-4 ratio)

    • Antibody titer determination

  • Competitive index assays:

    • Co-infection with wild-type and mutant strains

    • Measure relative survival and colonization abilities

Molecular methods:

  • Protein-protein interaction studies:

    • Co-immunoprecipitation to identify YajC binding partners

    • Bacterial two-hybrid systems

    • Cross-linking followed by mass spectrometry

  • Membrane protein topology mapping:

    • PhoA/LacZ fusion analyses

    • Protease accessibility assays

These methodologies provide a comprehensive toolkit for investigating YajC's role in bacterial pathogenesis across multiple experimental systems .

How might YajC be utilized in developing vaccines against brucellosis?

YajC shows significant potential for brucellosis vaccine development through several approaches:

As a subunit vaccine component:

  • YajC can be expressed as a recombinant protein and formulated with appropriate adjuvants to stimulate Th1-biased immune responses .

  • Its ability to induce both antibody production and cell-mediated immunity (particularly IFN-γ production) makes it a promising candidate .

As part of a multi-antigen vaccine:

  • YajC could be combined with other Brucella immunogens like Cu,Zn SOD to create more comprehensive protection .

  • Such combinations may address the limitations of single-antigen approaches.

As a component of vector-based vaccines:

  • Similar to the approach with Cu,Zn SOD, YajC could be expressed in safe bacterial vectors like Ochrobactrum anthropi .

  • When combined with immunostimulatory components like CpG oligonucleotides, such vaccines have shown promise in redirecting immune responses toward protective Th1-type immunity .

Vaccine delivery optimization:

  • Encapsulation in nanoparticles or liposomes

  • DNA vaccine encoding YajC

  • Viral vector-based delivery systems

Assessment methodology:

  • Measure antibody responses (particularly IgG2a in mice)

  • Evaluate T-cell responses through proliferation assays

  • Quantify cytokine production profiles (IFN-γ/IL-4 ratio)

  • Challenge studies in appropriate animal models

Unlike current live attenuated vaccines for animals (which have safety concerns for human use), YajC-based subunit vaccines could potentially offer safer alternatives for human brucellosis prevention .

What experimental protocols can be used to evaluate YajC-based vaccine efficacy?

Comprehensive evaluation of YajC-based vaccine candidates requires multi-faceted experimental approaches:

Immunogenicity assessment:

  • Antibody response analysis:

    • ELISA to measure total IgG, IgG1, and IgG2a titers in serum

    • Western blotting to confirm antibody specificity

    • Isotype profiling to determine Th1/Th2 balance

  • Cell-mediated immunity evaluation:

    • Lymphocyte proliferation assays using purified YajC as stimulant

    • Flow cytometry to analyze T-cell subsets (CD4+/CD8+)

    • Cytokine ELISPOTs for IFN-γ, IL-2, IL-4, IL-10 quantification

    • Intracellular cytokine staining

Protective efficacy assessment:

  • Challenge studies:

    • Vaccination followed by challenge with virulent Brucella strains

    • Bacterial burden quantification in spleen, liver, and lymph nodes

    • Survival rate and time monitoring

    • Histopathological examination of infected tissues

  • Protection markers:

    • Correlation of IFN-γ production with protection level

    • Assessment of macrophage activation status

    • Measurement of specific immune memory duration

Protocol example: Mouse model of protection

DayProcedure
0Immunize mice with recombinant YajC (50μg) with adjuvant
21Booster immunization
35Collect serum for antibody analysis
36Challenge with virulent B. abortus 2308 (104 CFU i.p.)
50Sacrifice; collect spleen, liver for bacterial enumeration

Data analysis:

  • Log reduction in bacterial burden compared to unvaccinated controls

  • Correlation between immune parameters and protection

  • Statistical analysis using ANOVA and appropriate post-hoc tests

These protocols allow for robust evaluation of YajC's potential as a vaccine candidate against brucellosis, with special emphasis on the Th1-biased immune response required for protection against this intracellular pathogen .

How can structural biology approaches enhance our understanding of YajC function?

Advanced structural biology techniques can provide critical insights into YajC's molecular function:

Structural determination methods:

  • X-ray crystallography:

    • Requires purification of recombinant YajC to homogeneity

    • May require removal of highly flexible regions

    • Can reveal atomic-level details of protein structure

  • Cryo-electron microscopy (Cryo-EM):

    • Particularly valuable for membrane protein complexes

    • Can visualize YajC in complex with SecYEG, YidC, and other partners

    • Sample preparation involves isolation of intact membrane complexes

  • NMR spectroscopy:

    • Useful for analyzing dynamic regions and interaction interfaces

    • Requires isotope-labeled protein production

Structure-function relationship studies:

  • Site-directed mutagenesis:

    • Identify critical residues for:

      • Membrane integration

      • Protein-protein interactions

      • Stability of complexes

  • Chimeric protein analysis:

    • Create fusion proteins between YajC domains from different species

    • Evaluate functional conservation across bacterial species

  • Molecular dynamics simulations:

    • Model YajC behavior in membrane environments

    • Predict conformational changes during protein translocation

These approaches could lead to mechanistic understanding of how YajC:

  • Stabilizes membrane protein insertion complexes

  • Facilitates protein retention at the cell surface

  • Contributes to biofilm formation and bacterial pathogenesis

Such structural insights would inform rational design of YajC-targeting antimicrobials or improved vaccine formulations.

What proteomics approaches can reveal YajC's interactome and functional networks?

Cutting-edge proteomics techniques can uncover YajC's interaction partners and place it within functional networks:

Interactome mapping:

  • Affinity purification-mass spectrometry (AP-MS):

    • Tag YajC with affinity labels (His, FLAG, etc.)

    • Purify YajC complexes under native conditions

    • Identify co-purified proteins by mass spectrometry

  • Proximity-dependent biotin labeling (BioID/APEX):

    • Fuse YajC to biotin ligase or peroxidase enzymes

    • Identify proteins in close proximity to YajC in living cells

    • Particularly valuable for transient interactions

  • Cross-linking mass spectrometry (XL-MS):

    • Use membrane-permeable crosslinkers to stabilize protein interactions

    • Identify specific interaction interfaces through MS analysis

Comparative proteomics:

  • Quantitative proteomics of wild-type vs. ΔyajC strains:

    • Profile membrane proteome changes

    • Identify mislocalized proteins in yajC mutants

    • Analyze secretome alterations

  • Temporal proteomics during infection:

    • Track YajC expression and interaction changes during host cell infection

    • Correlate with virulence phenotypes

Functional network analysis:

  • Bioinformatic integration:

    • Construct protein-protein interaction networks

    • Integrate with transcriptomic data

    • Identify functional clusters and pathways affected by YajC

  • Validation experiments:

    • Targeted gene knockouts of identified partners

    • Co-immunoprecipitation confirmation

    • Functional assays based on network predictions

These proteomics approaches would provide comprehensive understanding of YajC's role in:

  • Membrane protein secretion and retention

  • Biofilm formation pathways

  • Bacterial stress responses

  • Host-pathogen interactions

Such information could identify novel antimicrobial targets within YajC-dependent pathways or reveal additional antigens for multi-component vaccine development .

What are the key experimental challenges in YajC research and how can they be addressed?

Researchers face several challenges when studying YajC, each requiring specific technical approaches:

Challenge 1: Membrane protein expression and purification

  • Issue: Membrane proteins like YajC are notoriously difficult to express and purify in functional form.

  • Solutions:

    • Use specialized expression systems (C41/C43 E. coli strains designed for membrane proteins)

    • Express as fusion proteins with solubility enhancers like MBP

    • Optimize detergent conditions for extraction and purification

    • Consider native membrane nanodiscs for structural studies

Challenge 2: Functional redundancy in protein translocation pathways

  • Issue: Multiple pathways for membrane protein insertion may mask phenotypes in single gene knockouts.

  • Solutions:

    • Create combinatorial mutations in related pathway components

    • Use conditional depletion systems rather than complete knockouts

    • Analyze phenotypes under stress conditions that may magnify pathway dependencies

Challenge 3: Complexity of immune response assessment

  • Issue: Determining the protective efficacy requires complex immune readouts and challenge experiments.

  • Solutions:

    • Use standardized immune assays focusing on Th1/Th2 balance

    • Employ multi-parameter flow cytometry for comprehensive immune profiling

    • Develop in vitro correlates of protection to reduce animal testing

    • Standardize challenge protocols across laboratories

Challenge 4: Variability across bacterial species

  • Issue: YajC function may vary between Brucella and model organisms used for mechanistic studies.

  • Solutions:

    • Perform comparative genomic and functional analyses across species

    • Create complementation systems to test functional conservation

    • Use closely related model organisms (e.g., Ochrobactrum) when possible

Challenge 5: Translating basic findings to vaccine development

  • Issue: Moving from immunogenicity data to effective vaccine formulations.

  • Solutions:

    • Systematic testing of adjuvant combinations

    • Development of delivery platforms optimized for Th1 responses

    • Early integration of manufacturing considerations into research design

Addressing these challenges requires multidisciplinary approaches and often collaboration between structural biologists, microbiologists, immunologists, and vaccinologists.

How can researchers optimize heterologous expression systems for producing functional recombinant YajC?

Producing high-quality recombinant YajC requires optimization at multiple levels:

Expression vector selection:

  • Fusion tag considerations:

    • MBP fusion has proven successful for YajC expression

    • His-tagged constructs facilitate purification but may affect membrane integration

    • Consider removable tags with protease cleavage sites

  • Promoter selection:

    • Inducible promoters (T7, ara) allow controlled expression

    • Lower strength promoters may improve membrane protein folding

Expression host optimization:

  • Specialized E. coli strains:

    • C41(DE3)/C43(DE3) designed for membrane protein expression

    • Strains with modified membrane composition (e.g., BL21(DE3)pLysS)

    • Consider Lemo21(DE3) for tunable expression levels

  • Growth conditions:

    • Lower temperatures (16-25°C) after induction

    • Reduced inducer concentrations

    • Rich vs. minimal media comparison

    • Optimization table:

ParameterTest RangeTypical Optimal Conditions
Temperature16-37°C20°C post-induction
IPTG concentration0.1-1.0 mM0.2-0.5 mM for MBP fusions
Induction OD6000.4-1.00.6-0.8
Post-induction time3-18 hoursOvernight at lower temperatures

Membrane extraction and purification:

  • Detergent screening:

    • Mild detergents (DDM, LMNG) for initial extraction

    • Detergent exchange during purification

  • Purification strategy:

    • Two-step purification (affinity + size exclusion)

    • On-column detergent exchange

    • Buffer optimization to maintain stability

  • Functional validation:

    • Circular dichroism to confirm secondary structure

    • Thermal shift assays for stability assessment

    • Binding assays with known interaction partners

Alternative expression systems:

  • Cell-free expression:

    • Allows direct incorporation into liposomes or nanodiscs

    • Avoids toxicity issues

  • Non-E. coli bacterial systems:

    • Consider expression in Ochrobactrum anthropi for Brucella proteins

    • May provide better folding environment for YajC

These optimized protocols will yield functional recombinant YajC suitable for structural studies, immunological assays, and vaccine development efforts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.