Recombinant Brucella abortus Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Background on Brucella abortus and Brucellosis

Brucella species are Gram-negative bacteria that can infect animals and humans, leading to chronic infections with symptoms like undulant fever, arthritis, and osteomyelitis . Due to their infectiousness via aerosol routes and the lack of a safe and effective human vaccine, Brucella species are considered potential bioterrorism agents .

Mechanosensitive Channels (MscL)

Mechanosensitive channels, like MscL, are integral membrane proteins that respond to mechanical stimuli, such as changes in membrane tension . In bacteria, MscL channels are thought to play a role in protecting cells from osmotic shock by opening a pore in the membrane to release cytoplasmic solutes .

Recombinant MscL as a Vaccine Component

Recombinant DNA technology allows scientists to produce large quantities of specific proteins, like MscL, for use in vaccines . Subunit vaccines, which use only specific parts of a pathogen, can avoid the risks associated with live attenuated vaccines, such as reversion to virulence or causing abortions in pregnant animals . Several Brucella proteins, including outer membrane proteins and ribosomal proteins, have been investigated as potential subunit vaccines .

Research Findings on Recombinant Brucella abortus MscL

While the provided resources do not focus specifically on MscL, they highlight research on other recombinant Brucella abortus proteins as potential vaccine candidates. For example, a combination of recombinant proteins like ribosomal protein L7/L12, outer membrane protein (OMP) 22, OMP25, and OMP31 has shown promise as a combined subunit vaccine (CSV) against B. abortus infection .

  • Immunogenicity: These recombinant proteins react with Brucella-positive serum but not with Brucella-negative serum, indicating their potential to be recognized by the immune system .

  • Immune Response: Immunization with these proteins can induce a T-helper-1-dominated immune response, characterized by the production of IFN-γ and IL-2 .

  • Protective Efficacy: Studies in murine models have demonstrated that CSVs can provide superior protection against brucellosis compared to single subunit vaccines .

Another study explored the use of listeriolysin O (LLO) expression of Listeria monocytogenes, BAX, and SMAC apoptotic proteins in strain RB51 to enhance vaccine efficacy and safety . The results indicated that RB51 recombinants had lower macrophage survival rates and caused higher levels of apoptosis and necrosis, leading to an enhanced Th1 immune response .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
mscL; BAbS19_I03180; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-138
Protein Length
full length protein
Species
Brucella abortus (strain S19)
Target Names
mscL
Target Protein Sequence
MLKEFQEFALKGNMVDLAIGVIIGGAFGGLVNSIVNDIIMPIIGLITGGIDFSNMFIQLA GDPKTTLAAAREAGATIAYGNFITLLINFLIIAWVLFLVVKLMNRLKKREEAKPAPAAPS EEVLLTEIRDILAKQQKA
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating intracellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of Brucella abortus mscL protein?

The Brucella abortus large-conductance mechanosensitive channel (mscL) is a membrane protein consisting of 138 amino acids. Its complete amino acid sequence is: mLKEFQEFALKGNMVDLAIGVIIGGAFGGLVNSIVNDIIMPIIGLITGGIDFSNMFIQLAGDPKTTLAAAAREAGATIAYGNFITLLINFLIIAWVLFLVVKLMNRLKKREEAKPAPAAPSEEVLLTEIRDILAKQQKA. This protein forms transmembrane channels that respond to membrane tension, allowing the bacterium to regulate osmotic pressure and maintain membrane integrity under various environmental conditions .

What are the optimal storage conditions for recombinant Brucella abortus mscL protein?

For optimal stability and activity, recombinant mscL protein should be stored in a Tris-based buffer containing 50% glycerol. Short-term storage can be maintained at 4°C for up to one week. For long-term preservation, store at -20°C, and for extended storage periods, maintain at -80°C. Importantly, repeated freeze-thaw cycles should be avoided as they can significantly compromise protein integrity and function. When working with the protein, it is advisable to create single-use aliquots to minimize freeze-thaw damage .

How can researchers effectively express recombinant mscL in heterologous systems?

Effective expression of recombinant mscL requires careful consideration of the expression system and ribosomal binding site (RBS). Based on studies with other Brucella proteins, the RBS composition significantly impacts expression levels. To optimize expression, researchers should consider:

  • Modifying the Shine-Dalgarno sequence to match the requirements of the expression host

  • Adjusting the spacer length between the Shine-Dalgarno sequence and start codon

  • Selecting an appropriate tag that doesn't interfere with protein folding or function

It's crucial to note that optimal RBS configurations differ between E. coli and Brucella-based expression systems. Studies show that RBS modifications that increase expression in E. coli may actually decrease expression in Brucella, highlighting the importance of system-specific optimization .

What purification strategies yield the highest quality recombinant mscL protein?

While specific purification protocols for mscL are not detailed in the provided research, effective purification of membrane proteins like mscL typically involves:

  • Initial solubilization with appropriate detergents that maintain protein structure

  • Affinity chromatography using the attached tag (the specific tag for mscL is determined during the production process)

  • Size exclusion chromatography to remove aggregates and obtain homogeneous protein samples

  • Validation of protein quality through techniques such as SDS-PAGE, western blotting, and activity assays

For functional studies, researchers should verify that the purified mscL retains its mechanosensitive properties, possibly through electrophysiological techniques like patch-clamp analysis .

How does RBS modification affect mscL expression in Brucella?

The ribosomal binding site (RBS) plays a critical role in determining mscL expression levels in Brucella. Research using reporter systems has demonstrated that both the Shine-Dalgarno sequence and the spacer region between this sequence and the start codon significantly influence protein expression. Interestingly, optimization strategies differ between E. coli and Brucella systems. For example, optimizing the Shine-Dalgarno sequence increased expression 4-fold in E. coli but decreased expression to approximately 75% in Brucella. Similarly, a spacer length of zero nucleotides increased expression 1.5-fold in E. coli but reduced it to 50% in Brucella .

What transcriptional regulators influence mscL expression in Brucella?

While direct regulation of mscL is not specified in the provided research, Brucella employs complex transcriptional regulatory networks that likely influence mscL expression. The MucR regulator, for example, controls a diverse set of genes involved in cell envelope integrity and polysaccharide biosynthesis, functions potentially related to mscL activity. MucR operates through direct binding to promoter regions of its target genes and exhibits autoregulation by binding to its own promoter. The interplay between MucR and other regulators like ArsR6 (NolR) creates a regulatory network that may indirectly influence mscL expression in response to environmental conditions encountered during infection .

How can researchers manipulate mscL expression for functional studies?

To manipulate mscL expression for functional studies, researchers can employ several strategies:

  • RBS modification: Altering the Shine-Dalgarno sequence and spacer length can fine-tune expression levels. For reduced expression in Brucella, increasing the spacer length to 4-12 nucleotides with A or G repeats has proven effective.

  • Inducible promoter systems: While not directly mentioned in the search results, standard inducible systems like tetracycline-responsive promoters could be adapted for Brucella.

  • Reporter fusion: Creating mscL-fluorescent protein fusions (similar to the mCherry system described) enables real-time monitoring of expression and localization.

The choice of strategy depends on the specific experimental goals, with considerations for potential effects on protein function and cellular physiology .

What techniques are most effective for studying mscL channel activity?

For functional analysis of mscL channel activity, researchers should consider multiple complementary approaches:

  • Electrophysiological methods: Patch-clamp recording of reconstituted channels in liposomes or spheroplasts provides direct measurement of channel conductance and gating properties.

  • Fluorescence-based assays: Membrane-impermeable fluorescent dyes can be used to monitor channel opening in response to osmotic shock.

  • Growth phenotype analysis: Comparing growth of mscL-expressing and non-expressing strains under osmotic stress conditions can reveal functional significance.

  • Proteomics approaches: Mass spectrometry analysis of purified mscL can identify post-translational modifications or interacting proteins that modulate channel function.

Each approach provides unique insights into different aspects of channel function and should be selected based on specific research questions .

How does mscL function relate to Brucella virulence and pathogenesis?

The relationship between mscL function and Brucella virulence involves several potential mechanisms:

  • Osmotic adaptation: During infection, Brucella encounters varying osmotic environments, from extracellular spaces to the intracellular compartments of host cells. mscL likely contributes to bacterial adaptation to these changes.

  • Membrane integrity: mscL helps maintain membrane integrity under stress conditions, potentially working in concert with LPS components whose expression is regulated by transcription factors like MucR.

  • Virulence factor secretion: While not directly demonstrated for mscL, mechanosensitive channels in some bacteria contribute to the secretion of certain virulence factors.

Research on other Brucella membrane components suggests that proper membrane function is critical for virulence. For example, mutations affecting LPS components like LptA and LpxO result in attenuated strains with decreased resistance to antimicrobial peptides like Polymyxin B, indicating that membrane integrity contributes significantly to pathogenic potential .

What are the challenges in developing mscL-targeted antimicrobial strategies?

Developing antimicrobial strategies targeting mscL presents several challenges:

  • Structural conservation: Mechanosensitive channels share structural similarities across bacterial species and potentially with eukaryotic homologs, complicating selective targeting.

  • Redundancy: Bacteria often possess multiple mechanosensitive channels with overlapping functions, potentially allowing compensation if one channel is inhibited.

  • Delivery: Compounds targeting mscL must reach the bacterial membrane, requiring appropriate solubility and permeability properties.

  • Resistance development: Bacteria might develop resistance through mutations in mscL or by upregulating alternative osmotic regulation mechanisms.

Despite these challenges, the essential nature of osmotic regulation for bacterial survival makes mscL a potentially valuable target for novel antimicrobial development, particularly in combination with other membrane-targeting strategies .

How do mscL interactions with LPS components affect Brucella membrane properties?

The interaction between mscL and LPS components represents a critical yet under-explored area of Brucella membrane biology. While direct interaction studies are not detailed in the provided research, functional connections likely exist. LPS modifications significantly impact membrane properties, including permeability and resistance to antimicrobial compounds like Polymyxin B. Research has shown that alterations in LPS-related genes like LptA and LpxO lead to weaker LPS integrity and increased sensitivity to Polymyxin B. As a mechanosensitive channel responding to membrane tension, mscL function is almost certainly influenced by these LPS-dependent membrane properties. Conversely, mscL activity may affect membrane dynamics in ways that influence LPS organization and presentation at the bacterial surface .

What structural analysis techniques provide the most insight into mscL function?

Advanced structural analysis of mscL requires multiple complementary techniques:

  • Cryo-electron microscopy (cryo-EM): Enables visualization of the channel in different conformational states, particularly valuable for understanding gating mechanisms.

  • X-ray crystallography: Provides high-resolution structural information, though challenging for membrane proteins like mscL.

  • Molecular dynamics simulations: Allows computational modeling of channel behavior under different membrane tension conditions.

  • Site-directed spin labeling combined with electron paramagnetic resonance (EPR): Provides information about dynamic conformational changes during channel gating.

  • Mass spectrometry-based approaches: Helps identify post-translational modifications and protein-protein interactions that may modulate channel function.

These techniques, used in combination, can provide comprehensive understanding of how mscL structure relates to its mechanosensitive properties in the context of the Brucella membrane .

How can genetic modifications of mscL be leveraged for attenuated vaccine development?

Genetic modification of mscL presents a promising approach for developing attenuated Brucella vaccines. Building on research showing that RBS modifications can fine-tune gene expression without complete gene knockout, researchers could:

  • Reduce mscL expression through RBS modification: Similar to the approach used for LPS-related genes, where RBS alterations maintained 3/4 of normal protein expression while reducing virulence.

  • Introduce conditional mutations: Create mscL variants that function normally under standard conditions but exhibit reduced function under in vivo conditions.

  • Combine with other attenuating modifications: As single-gene knockouts often fail to balance reduced virulence with sufficient immunogenicity, combining mscL modifications with alterations in other virulence factors may yield better vaccine candidates.

The advantage of this approach over gene knockout is preservation of bacterial immunogenicity while reducing pathogenicity. Similar approaches with LPS-related genes have yielded mutant strains that retain LPS integrity but show reduced virulence, as evidenced by increased sensitivity to antimicrobial peptides like Polymyxin B .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.