Recombinant Brucella abortus Lectin-like protein BA14k (BAbS19_II04750)

What is the Brucella abortus Lectin-like protein BA14k?

The Lectin-like protein BA14k is a 14-kDa immunogenic protein found in Brucella abortus, a facultative intracellular zoonotic pathogen. This protein possesses lectin-like properties, including immunoglobulin binding and hemagglutination capabilities. The protein is encoded by gene BAbS19_II04750 in B. abortus strain S19 and BAB2_0505 in strain 2308, with corresponding UniProt accession numbers B2SAT5 and Q2YKY9, respectively .

What is the amino acid sequence and structural characteristics of BA14k?

The full amino acid sequence of the Lectin-like protein BA14k is: APMNMDRPAINQNVIQARAHYRPQNYNRGHRPGYWHGHRGYRHYRHGYRRHNDGWWYPLA AFGAGAIIGGAISQPRPVYRAPAGSPHVQWCYSRYKSYRASDNTFQPYNGPRKQCRSPYSR. The functional expression region spans amino acids 27-147. Structural analysis shows a high proportion of glycine, arginine, and proline residues, potentially contributing to its lectin-like properties .

What carbohydrate binding specificity does BA14k exhibit?

Hemagglutination inhibition experiments indicate that the BA14k protein demonstrates specific affinity toward mannose. This carbohydrate binding specificity is central to its lectin-like properties and may play a role in host-pathogen interactions during Brucella infection. The protein's mannose-binding capability suggests it may interact with mannose-containing glycoproteins on host cell surfaces .

How can recombinant BA14k protein be effectively expressed and purified?

The recombinant BA14k protein can be expressed using standard bacterial expression systems, with optimization for codon usage and inclusion of appropriate tags for subsequent purification. For optimal expression, the recommended approach involves:

• Cloning the coding sequence (amino acids 27-147) into a suitable expression vector

• Transformation into an E. coli expression strain

• Induction of protein expression under optimized conditions

• Purification using affinity chromatography

• Storage in Tris-based buffer with 50% glycerol at -20°C to -80°C

For working solutions, researchers should prepare small aliquots to avoid repeated freeze-thaw cycles and maintain activity .

What molecular techniques can be used to study BA14k gene function in Brucella?

To investigate BA14k gene function, several approaches have proven effective:

• Gene disruption through homologous recombination

• Complementation studies using plasmid-based expression

• Site-directed mutagenesis to modify specific functional domains

• Overexpression of the protein in attenuated strains like RB51

• Reporter gene fusion to study expression patterns

These techniques have been successfully employed to demonstrate the protein's role in virulence and LPS synthesis. For gene disruption studies, careful confirmation of mutants through both PCR and immunoblotting is essential to ensure complete inactivation .

What assays can detect the lectin-like properties of BA14k protein?

The lectin-like properties of BA14k can be evaluated through:

• Hemagglutination assays using erythrocytes from various animal species

• Hemagglutination inhibition using different carbohydrates to determine specificity

• Solid-phase binding assays to quantify interactions with immunoglobulins

• Surface plasmon resonance to measure binding kinetics with potential ligands

• Glycan array screening to identify comprehensive binding profiles

Results from these assays should be analyzed using appropriate statistical methods to establish significance. Hemagglutination assays have proven particularly useful in demonstrating the protein's mannose specificity .

How does BA14k contribute to B. abortus virulence?

BA14k plays a critical role in B. abortus virulence through multiple mechanisms:

• Direct or indirect involvement in smooth LPS synthesis

• Contribution to bacterial cell envelope integrity

• Possible role in host cell interaction through mannose-binding activity

Disruption of the gene encoding BA14k in virulent B. abortus strain 2308 induces a rough-like phenotype with altered smooth LPS immunoblot profile. This mutation causes a significant reduction in the bacterium's ability to replicate in mouse spleens, demonstrating its essential role in virulence. The mutant strain shows reduced survival in mouse models compared to wild-type bacteria .

What is the relationship between BA14k and LPS structure in B. abortus?

The relationship between BA14k and LPS structure is evidenced by:

This data suggests BA14k is involved in the biosynthesis or assembly of smooth LPS, a major virulence factor of B. abortus. The altered LPS profile in the mutant strain directly correlates with reduced pathogenicity .

How do BA14k knockout strains behave in animal infection models?

In animal infection models, BA14k knockout strains exhibit distinct behavior:

• In virulent strain 2308 background: The mutant strain shows significantly reduced replication in mouse spleens but maintains stable persistence at 2.0-2.6 log₁₀ CFU/spleen from day 1 to week 6 after intraperitoneal inoculation with 4.65 log₁₀ CFU

• In rough attenuated strain RB51 background: Disruption of BA14k has no effect on the mouse clearance pattern

How does BA14k differ between B. abortus strains 2308 and S19?

When comparing BA14k between B. abortus strains:

What is the significance of BA14k gene disruption in smooth vs. rough Brucella strains?

The impact of BA14k gene disruption varies significantly between smooth and rough strains:

• In smooth virulent strain 2308: Disruption leads to a rough-like phenotype, altered LPS profile, and reduced virulence

• In naturally rough attenuated strain RB51: Disruption has no apparent effect on mouse clearance pattern

This differential impact suggests that BA14k's role in virulence is intimately connected to the smooth LPS structure. In already rough strains like RB51, which lack the complete O-polysaccharide, BA14k disruption becomes redundant in terms of affecting bacterial clearance. This provides strong evidence that BA14k's primary contribution to virulence is through its involvement in smooth LPS synthesis or maintenance .

How is BA14k recognized by the host immune system?

BA14k has been identified as immunogenic in animals infected with Brucella species. The protein generates:

• Significant antibody responses in naturally and experimentally infected hosts

• Recognition by T cells, contributing to cell-mediated immunity

• Potential activation of innate immune receptors through its lectin-like properties

The immunogenicity of this protein suggests it is accessible to the host immune system during infection, either through secretion, surface exposure, or release after bacterial lysis. This accessibility makes it a potential target for diagnostic and vaccine development .

What experimental approaches can assess BA14k immunogenicity for vaccine development?

To evaluate BA14k's potential in vaccine development, researchers can employ:

• Recombinant protein immunization trials with various adjuvants

• DNA vaccination using the BA14k gene

• Construction of live attenuated strains overexpressing BA14k

• T-cell proliferation assays to assess cell-mediated response

• Cytokine profiling to characterize immune response quality

Immunization studies should carefully measure both humoral and cell-mediated responses, as cell-mediated immunity plays a critical role in protection against brucellosis. The comparative evaluation of BA14k-based immunization with established vaccine strains (S19, RB51) would provide valuable context for protective efficacy .

How might the lectin-like properties of BA14k be exploited for novel therapeutic approaches?

The lectin-like properties of BA14k present several potential therapeutic applications:

• Development of targeted antimicrobials that interfere with BA14k-mediated processes

• Design of glycomimetic compounds that block BA14k-host interactions

• Creation of subunit vaccines incorporating BA14k to induce protective immunity

• Use as a delivery vehicle for targeting mannose-rich surfaces of specific cell types

• Application in diagnostic platforms leveraging its carbohydrate-binding specificity

These approaches would require detailed structural characterization of BA14k's binding domains and careful optimization of targeting specificity to avoid cross-reactivity with host lectins .

What is the relationship between BA14k and bacterial persistence in chronic brucellosis?

The relationship between BA14k and bacterial persistence presents an intriguing research direction:

• BA14k-disrupted mutants maintain stable but reduced bacterial loads in mouse models

• The protein may influence transition from acute to chronic infection phases

• Potential involvement in intracellular survival mechanisms

• Possible role in modulating host immune responses to favor persistence

Understanding this relationship could provide insights into the mechanisms of chronic brucellosis and identify novel therapeutic targets for addressing persistent infections, which remain a significant challenge in brucellosis treatment .

What are the optimal storage and handling conditions for recombinant BA14k?

For optimal preservation of BA14k activity:

• Store stock solutions at -20°C to -80°C in Tris-based buffer with 50% glycerol

• Avoid repeated freeze-thaw cycles by preparing working aliquots

• Store working aliquots at 4°C for up to one week

• If using in functional assays, validate activity after storage using hemagglutination tests

• Consider the addition of protease inhibitors if degradation is observed

These conditions help maintain protein stability and functional integrity for experimental applications. The high glycerol content prevents freeze-damage to the protein structure and preserves lectin activity .

What controls should be included when working with recombinant BA14k in experimental settings?

When conducting experiments with recombinant BA14k, researchers should include:

• Denatured protein control to confirm activity depends on native conformation

• Carbohydrate inhibition controls (particularly mannose) to verify lectin specificity

• Tagged protein control to assess tag interference with functional properties

• Dose-response experiments to determine optimal protein concentrations

• Parallel testing with other lectins of known specificity for comparative analysis

Additionally, when evaluating gene function through knockout studies, complementation with the wild-type gene is essential to confirm that phenotypic changes are due to the specific gene disruption rather than polar effects or secondary mutations .

What aspects of BA14k function remain controversial or unexplained?

Several aspects of BA14k function remain to be fully elucidated:

• The precise molecular mechanism by which BA14k influences LPS synthesis

• Whether its lectin activity is directly involved in virulence or represents a secondary function

• The specific host targets or receptors with which BA14k interacts

• The subcellular localization and potential secretion mechanisms of BA14k

• How BA14k expression is regulated during different stages of infection

These unresolved questions present opportunities for future research to better understand this multifunctional protein and its role in Brucella pathogenesis .

How can researchers address contradictory findings regarding BA14k function?

To resolve contradictions in BA14k research:

• Employ multiple experimental approaches to verify findings

• Carefully control for strain differences when comparing results across studies

• Use standardized methodologies for protein production and functional assays

• Perform comprehensive genetic and phenotypic characterization of mutant strains

• Consider the influence of experimental conditions on protein function

Additionally, collaborative efforts between laboratories using different model systems could help establish consensus on BA14k function and reconcile apparently contradictory findings. Meta-analysis of existing data may also highlight patterns that explain seemingly discordant results .