Recombinant Brucella abortus NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery times.
Note: All protein shipments are delivered with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; BAbS19_I07760; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Brucella abortus (strain S19)
Target Names
nuoK
Target Protein Sequence
MEIGIAHYLTVSAILFTLGVFGIFLNRKNVIVILMSIELILLSVNLNFVAFSSQLGDLVG QVFALFVLTVAAAEAAIGLAILVVFFRNRGSIAVEDVNVMKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transport from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, ubiquinone is considered the primary electron acceptor for the enzyme. The enzyme couples the redox reaction with proton translocation, moving four hydrogen ions across the cytoplasmic membrane for every two electrons transferred, thereby conserving redox energy as a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of NADH-quinone oxidoreductase subunit K in Brucella abortus?

NADH-quinone oxidoreductase subunit K (nuoK) is a component of Complex I in the respiratory chain of Brucella abortus. It participates in the electron transport process by facilitating electron transfer from NADH to quinone molecules, contributing to energy production through oxidative phosphorylation. In B. abortus, this process is crucial for survival within host cells, where the bacterium must adapt to microaerobic conditions. The protein likely contributes to the pathogen's ability to persist in various environments encountered during infection, including the nutrient-limited conditions within macrophages . Understanding this functional role requires examining both structural components and their relationship to bacterial metabolism and virulence.

How is the nuoK gene structured in the Brucella abortus genome?

The nuoK gene in Brucella abortus exists as part of the nuo operon, which encodes multiple subunits of the NADH-quinone oxidoreductase complex. Typically, this gene is conserved across Brucella species and contains characteristic sequence motifs found in other proteobacteria. Researchers should analyze the promoter regions, regulatory elements, and gene organization within the operon to understand expression patterns. Comparative genomic analyses with other alpha-proteobacteria can provide insights into evolutionary conservation of this gene. When analyzing gene structure, it's important to consider both coding regions and regulatory elements that control expression during different growth phases and environmental conditions encountered during infection .

What expression systems are most effective for producing recombinant nuoK protein?

For recombinant expression of Brucella abortus nuoK, E. coli-based systems have shown reasonable success, particularly when using vectors that provide tight regulation of expression. Since nuoK is a membrane protein, specialized E. coli strains designed for membrane protein expression (such as C41(DE3) or C43(DE3)) often yield better results than standard strains. Expression conditions typically require optimization of temperature (often reduced to 16-25°C), inducer concentration, and duration to minimize inclusion body formation.

Expression SystemAverage Yield (mg/L)SolubilityPurification Complexity
E. coli BL21(DE3)0.5-1.0ModerateHigh
E. coli C41(DE3)1.5-2.5GoodModerate
E. coli SHuffle0.8-1.2ModerateHigh
Insect Cell System2.0-3.0ExcellentModerate
Cell-Free System0.3-0.6VariableLow

Alternative systems like insect cells may provide better folding for functional studies, though at higher cost and complexity. The choice of expression system should be guided by the intended experimental application, whether structural analysis, functional characterization, or antibody production .

How does the structure of nuoK relate to its function in electron transport?

The structure of NADH-quinone oxidoreductase subunit K (nuoK) from Brucella abortus likely consists of transmembrane helices that position the protein within the membrane domain of Complex I. Within this structure, specific residues create a hydrophobic environment conducive to quinone binding and electron transfer. Based on structural analyses of homologous proteins, key residues (potentially including conserved arginines, glutamines, and tyrosines) may participate in substrate stabilization and catalysis. For example, positively charged residues might interact with the negatively charged regions of quinone molecules, similar to how R45, Q48, and Y54 residues function in the quinone oxidoreductase from Phytophthora capsici .

The spatial arrangement of these residues creates a microenvironment that facilitates electron transfer from NADH to quinone, contributing to the proton-motive force necessary for ATP synthesis. Researchers should examine structure-function relationships through techniques such as site-directed mutagenesis of predicted catalytic residues combined with functional assays measuring electron transfer efficiency or proton translocation. Comparative analysis with other bacterial NADH-quinone oxidoreductases can provide insights into conserved structural elements essential for function.

What methods can resolve the membrane topology of recombinant nuoK?

Determining the membrane topology of recombinant Brucella abortus nuoK requires a multi-technique approach:

  • Cysteine scanning mutagenesis: Systematically replacing residues with cysteine and assessing their accessibility using membrane-impermeable sulfhydryl reagents can map exposed regions.

  • Fluorescence-based techniques: Introducing fluorescent probes at specific positions followed by quenching experiments can determine the orientation relative to the membrane.

  • Protease protection assays: Limited proteolysis of membrane preparations containing the recombinant protein followed by mass spectrometry can identify exposed regions.

  • Electron crystallography: For higher resolution structural data, 2D crystals of purified nuoK can be analyzed by electron microscopy.

  • Computational prediction validation: Experimental results should be compared with predictions from algorithms like TMHMM, HMMTOP, or MEMSAT to validate in silico models.

TechniqueResolutionSample RequirementsTechnical DifficultyInformation Gained
Cysteine ScanningResidue-levelPurified proteinModerateAccessibility of specific residues
Protease ProtectionDomain-levelMembrane preparationsLowLarge structural features
Electron Crystallography3-8 Å2D crystalsVery HighDetailed structural information
Computational PredictionVariableSequence onlyLowInitial topology model
Fluorescence QuenchingSegment-levelLabeled proteinModerateBoundary determination

The integration of these approaches provides complementary data that can establish a comprehensive topological model of nuoK within the membrane .

How can protein-protein interactions within the NADH-quinone oxidoreductase complex be mapped?

Mapping protein-protein interactions within the NADH-quinone oxidoreductase complex containing nuoK requires several complementary approaches:

  • Cross-linking coupled with mass spectrometry: Chemical cross-linkers of various lengths can capture transient interactions, and subsequent proteomic analysis can identify interacting partners and approximate interaction sites.

  • Co-immunoprecipitation with tagged subunits: Expressing epitope-tagged versions of nuoK or other complex subunits allows for specific pulldown of interaction partners.

  • Bacterial two-hybrid systems: Modified for membrane proteins, these can detect binary interactions between nuoK and other subunits.

  • Surface plasmon resonance: Using purified components to measure binding kinetics and affinity between nuoK and partner proteins.

  • Cryo-electron microscopy: For holistic structural analysis of the entire complex, revealing the spatial arrangement of nuoK relative to other subunits.

Analysis should focus on identifying conserved interaction interfaces and understanding how these interactions contribute to complex assembly and stability. Researchers should consider both stable structural interactions and transient functional interactions that may occur during the catalytic cycle. A thorough understanding of these interactions provides insights into how electron transfer is coordinated across the complex and how disrupting specific interfaces might affect pathogen viability .

What purification strategies yield functional recombinant nuoK protein?

Purifying functional recombinant Brucella abortus nuoK protein presents challenges due to its membrane-embedded nature. A comprehensive purification strategy includes:

  • Membrane extraction: Selective solubilization using mild detergents like n-dodecyl-β-D-maltoside (DDM), lauryl maltose neopentyl glycol (LMNG), or digitonin preserves protein structure better than harsher detergents like Triton X-100.

  • Affinity chromatography: Utilizing a His-tag or other fusion tags positioned to avoid interference with functional domains, followed by careful optimization of imidazole gradients for elution.

  • Size exclusion chromatography: Critical for separating properly folded protein from aggregates and ensuring homogeneity.

  • Detergent exchange: If required for downstream applications, gradual exchange to different detergents or reconstitution into nanodiscs or liposomes.

Purification StepBuffer CompositionCritical ParametersQuality Control
Membrane Isolation50 mM Tris-HCl pH 7.5, 200 mM NaCl, 10% glycerolCentrifugation speed and durationWestern blot
Solubilization50 mM Tris-HCl pH 7.5, 200 mM NaCl, 1% DDM, 10% glycerolDetergent:protein ratio, temperatureSolubilized protein quantification
Affinity Chromatography50 mM Tris-HCl pH 7.5, 200 mM NaCl, 0.05% DDM, 10% glycerolImidazole concentration, flow rateSDS-PAGE
Size Exclusion50 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.03% DDMFlow rate, fraction collectionDynamic light scattering

Functional assessment through activity assays measuring NADH oxidation or quinone reduction should be performed at each purification stage to monitor retention of catalytic properties. Protein stability should be verified through thermal shift assays, monitoring both detergent concentration and buffer composition effects on protein stability .

What assays can effectively measure nuoK activity in vitro?

Measuring the activity of Brucella abortus nuoK in vitro requires assays that can detect electron transfer within the NADH-quinone oxidoreductase complex:

  • NADH oxidation assay: Spectrophotometric monitoring of NADH disappearance at 340 nm provides a direct measure of complex activity. This should be performed with purified complex or reconstituted system containing nuoK.

  • Artificial electron acceptor reduction: Using artificial electron acceptors like ferricyanide or dichlorophenolindophenol (DCIP) with spectrophotometric detection.

  • Oxygen consumption measurements: Using oxygen electrodes to measure respiratory activity when nuoK is reconstituted in proteoliposomes.

  • Quinone reduction assays: Measuring the reduction of ubiquinone analogues through changes in absorbance or fluorescence properties.

  • Proton translocation measurements: Using pH-sensitive fluorescent dyes in liposome-reconstituted systems to detect proton pumping activity.

Assay TypeDetection MethodSensitivitySpecificity for nuoK FunctionTechnical Complexity
NADH OxidationSpectrophotometry (340 nm)HighModerateLow
Quinone ReductionSpectrophotometry (275 nm)ModerateHighModerate
Oxygen ConsumptionElectrode MeasurementHighLowModerate
Proton TranslocationFluorescenceHighHighHigh
Artificial Electron AcceptorsColorimetricHighLowLow

Researchers should include appropriate controls such as specific inhibitors (rotenone, piericidin A) to confirm the specificity of the measured activity. Additionally, site-directed mutants of key residues can validate the assay's sensitivity to structural perturbations of nuoK .

How can structural studies of nuoK be optimized for crystallography or cryo-EM analysis?

Optimizing structural studies of Brucella abortus nuoK for high-resolution techniques requires addressing several challenges unique to membrane proteins:

  • Protein stability enhancement:

    • Screening multiple detergents and lipid mixtures to identify conditions that maintain structural integrity

    • Testing protein engineering approaches like thermostabilizing mutations or fusion partners

    • Utilizing nanodiscs or lipidic cubic phase (LCP) systems to mimic the native membrane environment

  • Crystallization optimization for X-ray crystallography:

    • Implementing sparse matrix screening with commercial membrane protein-specific screens

    • Exploring in surfo and in meso crystallization methods

    • Testing various precipitants, temperatures, and additive combinations

    • Utilizing antibody fragments or nanobodies to stabilize flexible regions and promote crystal contacts

  • Sample preparation for cryo-EM:

    • Optimizing grid preparation parameters including blotting time, humidity, and temperature

    • Testing different grid types and surface treatments

    • Using Volta phase plates or energy filters to enhance contrast

    • Considering detergent exchange to amphipols or reconstitution into nanodiscs

Structural TechniqueResolution PotentialSample RequirementsAdvantagesLimitations
X-ray Crystallography1.5-3.5 ÅWell-diffracting crystalsAtomic resolution possibleCrystallization challenging
Single-particle Cryo-EM2.5-4.0 ÅHomogeneous protein preparationNo crystals neededSize constraints
Solid-state NMR3.0-5.0 ÅIsotopically labeled proteinDynamic informationResolution limitations
SAXS/SANS10-20 ÅMonodisperse solutionLow sample requirementsLow resolution

Researchers should consider pursuing multiple structural methods in parallel, as each provides complementary information. For complex membrane proteins like nuoK, structural determination often requires iterative optimization of constructs and conditions to achieve the resolution necessary for mechanistic insights .

How can researchers resolve contradictory data regarding nuoK function?

When facing contradictory data on Brucella abortus nuoK function, researchers should implement a systematic approach:

  • Methodological reconciliation: Examine differences in experimental conditions, protein preparation methods, and assay systems. For example, activity measurements may differ between detergent-solubilized and liposome-reconstituted nuoK due to the lipid environment's effect on protein conformation.

  • Construct verification: Confirm that all studies used identical protein sequences, as variations in tags, linkers, or accidental mutations can significantly impact function. Full sequencing of expression constructs and mass spectrometry verification of the purified protein should be standard practice.

  • Context-dependent function: Evaluate whether nuoK behavior varies across different biochemical environments. The function of respiratory chain components often depends on interactions with other subunits, which may be differentially present across studies.

  • Replication with standardized protocols: Establish benchmark protocols that can be implemented across laboratories to validate key findings. This might include standardized expression systems, purification methods, and activity assays.

  • Integration of multiple techniques: Combine biophysical, biochemical, and computational approaches to build a comprehensive model that explains apparent contradictions.

When analyzing contradictory literature, researchers should create comparison tables that explicitly identify experimental variables across studies, allowing for systematic identification of factors that might explain discrepancies .

What statistical approaches are appropriate for analyzing nuoK expression and activity data?

Statistical analysis of nuoK expression and activity data requires approaches tailored to biochemical and molecular biology experiments:

  • For expression optimization experiments:

    • Factorial design of experiments (DOE) to efficiently test multiple variables (temperature, inducer concentration, time)

    • ANOVA with post-hoc tests to identify significant factors affecting expression levels

    • Response surface methodology to identify optimal expression conditions

  • For protein activity measurements:

    • Michaelis-Menten kinetics analysis using non-linear regression

    • Enzyme inhibition models with appropriate curve fitting

    • Bootstrap resampling to estimate confidence intervals for kinetic parameters

  • For structure-function relationship studies:

    • Multiple comparison corrections (e.g., Bonferroni, Holm-Šídák) when testing multiple mutations

    • Principal component analysis to identify patterns in activity data across mutant libraries

Statistical TestApplicationSample Size RequirementsAssumptionsOutput Metrics
Two-way ANOVAComparing expression across conditionsMinimum 3 replicates per conditionNormal distribution, homogeneity of varianceF-statistic, p-values
Non-linear regressionFitting enzyme kinetics data10+ substrate concentrationsAppropriate model selectionKm, Vmax, R² values
Hierarchical clusteringGrouping similar mutant behaviors15+ mutantsDistance metric selectionDendrograms, cluster assignments
Power analysisExperimental design planningDepends on effect sizeEffect size estimationRequired sample size

Researchers should report not only p-values but also effect sizes and confidence intervals to provide a complete statistical picture. For complex datasets, consulting with a biostatistician can help ensure appropriate test selection and interpretation3.

How can computational models predict the impact of mutations on nuoK structure and function?

Computational approaches offer powerful tools for predicting how mutations affect Brucella abortus nuoK structure and function:

  • Homology modeling and threading: When experimental structures are unavailable, models can be built based on homologous proteins with known structures. These models provide a structural framework for mutation analysis.

  • Molecular dynamics simulations: Simulating the behavior of wild-type and mutant proteins in membrane environments can reveal changes in stability, flexibility, and conformational states. Key metrics include root-mean-square deviation (RMSD), root-mean-square fluctuation (RMSF), and analysis of hydrogen bonding networks.

  • Quantum mechanics/molecular mechanics (QM/MM): For analyzing mutations in the catalytic site, QM/MM calculations can predict changes in electron transfer capabilities and binding energies.

  • Machine learning approaches: Training models on existing mutation data from similar proteins can predict functional effects of novel mutations in nuoK.

  • Evolutionary analysis: Using tools like ConSurf to identify conserved residues across species, which often indicate functional importance.

An integrated approach combining multiple computational methods typically provides the most reliable predictions. Researchers should validate computational predictions with experimental methods such as site-directed mutagenesis followed by functional assays or structural studies .

How can nuoK be targeted for potential therapeutic development against brucellosis?

Targeting Brucella abortus NADH-quinone oxidoreductase subunit K (nuoK) for therapeutic development requires a multi-faceted approach:

  • Structure-based drug design: Using structural information about nuoK to identify potential binding pockets, particularly those that might disrupt electron transfer or protein-protein interactions within the respiratory complex. Virtual screening campaigns can identify compounds predicted to bind these sites with high affinity and specificity.

  • High-throughput screening: Developing robust assays to screen compound libraries for inhibitors of nuoK function, potentially using whole-cell assays measuring B. abortus viability or specific biochemical assays measuring Complex I activity.

  • Fragment-based drug discovery: Identifying small chemical fragments that bind to nuoK, which can then be elaborated into larger, more potent inhibitors with drug-like properties.

  • Peptide inhibitors: Designing peptides that mimic interface regions between nuoK and other subunits, potentially disrupting complex assembly.

Researchers should focus on identifying compounds that specifically target unique features of bacterial NADH-quinone oxidoreductases not present in mammalian homologs to minimize toxicity. The essential nature of respiratory chain function for B. abortus survival, particularly under the microaerobic conditions encountered during infection, makes nuoK an attractive target .

What role might nuoK play in Brucella abortus virulence and host adaptation?

The role of NADH-quinone oxidoreductase subunit K (nuoK) in Brucella abortus virulence and host adaptation likely centers on energy metabolism adaptation:

  • Metabolic flexibility: As a component of Complex I, nuoK contributes to the bacterium's ability to maintain energy production under various conditions encountered during infection. This includes adaptation to oxygen-limited environments within host cells, particularly macrophages where Brucella resides during infection.

  • Resistance to oxidative stress: The respiratory chain components may provide mechanisms to counter host-generated reactive oxygen species, contributing to intracellular survival.

  • Membrane potential maintenance: Proper function of the respiratory chain maintains the proton motive force necessary for various virulence-associated processes, including nutrient uptake systems and secretion mechanisms.

  • Metabolic adaptation to nutrient limitation: Within host cells, Brucella faces nutrient restrictions, and efficient energy production through respiratory chain components like nuoK may be crucial for adaptation to these conditions.

Researchers investigating this relationship should develop nuoK knockout or conditional mutants to assess impacts on intracellular survival, replication rates within macrophages, and virulence in animal models. Transcriptomic and proteomic comparisons between bacteria growing in standard media versus host-mimicking conditions could reveal regulation patterns of nuoK expression in response to host environments .

How can systems biology approaches integrate nuoK function into broader Brucella abortus metabolic networks?

Systems biology approaches can place nuoK function within the broader context of Brucella abortus metabolism through several integrated strategies:

Systems ApproachData RequirementsIntegration MethodOutputApplication
Metabolic ModelingGenome annotation, biomass compositionConstraint-based modelingFlux distributionsIdentifying essential pathways
Multi-omics IntegrationTranscriptomics, proteomics, metabolomicsNetwork analysisCorrelated response networksUnderstanding system-wide effects
Protein-Protein InteractionsCo-immunoprecipitation, Y2H dataNetwork visualizationInteraction mapsIdentifying functional modules
Comparative GenomicsGenomes from multiple strainsPathway enrichmentConserved modulesIdentifying core pathways

This systems-level understanding provides context for interpreting experimental results and can guide the development of more effective intervention strategies by identifying synergistic targets or predicting compensatory mechanisms that might limit therapeutic efficacy .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.