Recombinant Brucella abortus Phosphatidate cytidylyltransferase (cdsA)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Characteristics

Phosphatidate cytidylyltransferase (cdsA) is a key enzyme in bacterial lipid metabolism, facilitating the synthesis of phosphatidylglycerol and other membrane lipids essential for bacterial survival. In Brucella abortus, cdsA is encoded by the cdsA gene (strain 9-941, biovar 1) and shares conserved structural and functional features with homologs in Gram-negative bacteria .

Key Features:

ParameterDescription
Protein NamePhosphatidate cytidylyltransferase (cdsA)
Gene OriginBrucella abortus biovar 1 (strain 9-941)
Expressed RegionAmino acids 1–270
Expression SystemsE. coli, yeast, baculovirus, or mammalian cells
Purity>95% (His-tag affinity purification)
Molecular Weight~19.5 kDa (predicted)

Production and Purification

Recombinant cdsA is produced via heterologous expression in multiple systems, including E. coli, yeast, and mammalian cells, with E. coli being the most commonly cited platform . The protein is purified using immobilized metal affinity chromatography (IMAC) due to an N-terminal 6x histidine tag.

Production Workflow:

  1. Cloning: cdsA gene inserted into expression vectors (e.g., pCold-TF).

  2. Expression: Induced in E. coli BL21(DE3) or other systems.

  3. Purification: IMAC followed by SDS-PAGE validation under reducing conditions .

Applications in Research and Vaccine Development

While cdsA’s role in B. abortus pathogenesis is not explicitly detailed in available studies, its recombinant form is marketed for vaccine development. This aligns with broader trends in subunit vaccine research, where bacterial enzymes or structural proteins are targeted to elicit protective immune responses.

Potential Use Cases:

ApplicationRationale
Vaccine DevelopmentcdsA’s immunogenicity could be leveraged to induce T-cell responses.
Diagnostic ToolsAntigen for serological assays to detect anti-Brucella antibodies.
Structural StudiesAnalysis of enzyme-ligand interactions in lipid metabolism.

Research Gaps and Challenges

The provided literature lacks detailed functional or immunological studies on cdsA. Key questions remain unaddressed:

  • Enzymatic Activity: Does recombinant cdsA retain activity in vitro?

  • Immunogenicity: Does cdsA elicit Th1/Th2 responses or neutralizing antibodies?

  • Vaccine Efficacy: Comparative studies with other Brucella antigens (e.g., Omp19, L7/L12) are absent.

Comparative Analysis with Other Brucella Antigens

While cdsA is not extensively studied, other Brucella proteins like Omp19 and L7/L12 have demonstrated protective efficacy in subunit vaccines. Below is a comparison of key antigens:

AntigenFunctionVaccine PotentialReferences
cdsALipid biosynthesis enzymeTheoretical (no efficacy data)
Omp19Protease inhibitorHigh protection (Th1 response)
L7/L12Ribosomal proteinSynergistic with Omp16/Omp28
Omp16/Omp28Outer membrane proteinsInduce CD4+/CD8+ T-cell responses

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have any specific format requirements, please indicate them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
cdsA; BAB1_1179; Phosphatidate cytidylyltransferase; CDP-DAG synthase; CDP-DG synthase; CDP-diacylglycerol synthase; CDS; CDP-diglyceride pyrophosphorylase; CDP-diglyceride synthase; CTP:phosphatidate cytidylyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Brucella abortus (strain 2308)
Target Names
cdsA
Target Protein Sequence
MSNLQTRIITAIVLGTITLWLTWVGGVGFTLFSIAIGLAMFYEWTELSATRQTAFSRLFG WAWLIVTGILLILDRGALLTIGFLVAGCAILLVTQWKSGRGWPAAGLFYAGFSALSLSLL RGDEPFGFTTIVFLFAVVWSTDITAYFNGRALGGPKLAPRFSPNKTWSGAIGGAAAAVAG GLLVASLVAAPGGWGVPVLALLLSIVSQIGDLAESWVKRQFGAKDSGRLLPGHGGVLDRV DGLVAAAALLYLFGAIFAEPDVLSAIFFSF
Uniprot No.

Target Background

Database Links
Protein Families
CDS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of Phosphatidate cytidylyltransferase (CdsA) in Brucella abortus?

Phosphatidate cytidylyltransferase (CdsA) catalyzes a critical step in phospholipid biosynthesis, converting phosphatidic acid to CDP-diacylglycerol. This reaction is essential for the synthesis of various membrane phospholipids, including phosphatidylethanolamine (PE) and phosphatidylcholine (PC), which constitute the Brucella cell envelope. Research has demonstrated that membrane phospholipid composition is critical for Brucella's interaction with host cells and its virulence. For instance, disruption of phosphatidylserine synthase (PssA), which catalyzes the first step of PE biosynthesis, abrogates PE synthesis and impairs several virulence traits including intracellular survival in macrophages and HeLa cells, maturation of the replicative Brucella-containing vacuole, and mouse colonization .

How does phospholipid biosynthesis impact Brucella virulence?

The membrane phospholipid composition significantly influences Brucella virulence. Studies have shown that Brucella depends on specific phospholipids for optimal pathogenicity. In particular, phosphatidylcholine (PC) is necessary to sustain a chronic infection process, which suggests that membrane lipid content is relevant for Brucella virulence . Additionally, phosphatidylethanolamine (PE) is essential for optimal virulence, as its absence alters cell surface properties and impairs intracellular survival . These findings indicate that enzymes involved in phospholipid biosynthesis, including CdsA, represent potential targets for attenuating Brucella virulence.

What are the main challenges in expressing recombinant Brucella proteins?

Expressing recombinant Brucella proteins presents several challenges:

  • Protein solubility: Many Brucella membrane-associated proteins, like CdsA, may have hydrophobic domains that make them difficult to express in soluble form.

  • Host compatibility: Selection of appropriate expression systems that can produce functional Brucella proteins while minimizing toxicity.

  • Protein folding: Ensuring proper folding of the recombinant protein to maintain enzymatic activity.

  • Contamination concerns: Working with proteins from BSL-3 pathogens requires additional safety measures.

  • Validation of functionality: Confirming that the recombinant protein exhibits the same properties as the native protein.

These challenges can be addressed through optimization of expression vectors, use of fusion tags to enhance solubility, and careful selection of expression hosts like those used for other Brucella proteins, such as pCold-TF vector systems that have been demonstrated to express immunogenic Brucella proteins .

What expression systems are recommended for recombinant Brucella abortus CdsA production?

For recombinant Brucella CdsA expression, researchers should consider:

  • E. coli expression systems: BL21(DE3) strains with vectors containing strong inducible promoters like T7 have been successfully used for other Brucella proteins.

  • Cold-shock expression systems: The pCold-TF vector system has proven effective for expressing Brucella proteins . This system utilizes a cold-shock promoter and includes a trigger factor component that enhances solubility.

  • Fusion tags: Using solubility-enhancing tags such as MBP (maltose-binding protein), SUMO, or GST can improve recombinant protein yield and solubility.

  • Codon optimization: Adapting the CdsA gene sequence to the codon usage of the expression host can improve expression levels.

  • Membrane protein expression protocols: Since CdsA is a membrane-associated enzyme, specialized protocols for membrane protein expression may be necessary, including the use of detergents during purification.

Temperature, inducer concentration, and expression duration should be optimized based on preliminary expression trials to maximize yield of functional protein.

How can researchers assess the enzymatic activity of recombinant CdsA?

The enzymatic activity of recombinant CdsA can be assessed through several approaches:

  • Radiometric assays: Measuring the conversion of radiolabeled phosphatidic acid to CDP-diacylglycerol.

  • Coupled enzyme assays: Linking CdsA activity to a detectable enzymatic reaction.

  • HPLC or mass spectrometry: Quantifying substrate consumption and product formation.

  • Complementation studies: Testing whether the recombinant CdsA can rescue growth or functional defects in CdsA-deficient bacterial strains.

A typical enzymatic assay would include:

  • Recombinant CdsA protein

  • Phosphatidic acid substrate

  • CTP (cytidine triphosphate) co-substrate

  • Appropriate buffer system with Mg²⁺ as a cofactor

  • Detection system for CDP-diacylglycerol formation

Researchers should ensure proper controls, including heat-inactivated enzyme and reaction mixtures lacking key components, to validate assay specificity.

What purification strategies work best for membrane-associated enzymes like CdsA?

Purification of membrane-associated enzymes such as CdsA requires specialized approaches:

  • Detergent solubilization: Using mild detergents (e.g., n-dodecyl-β-D-maltoside, CHAPS) to extract the protein from membranes while maintaining structure and function.

  • Affinity chromatography: Utilizing fusion tags (His, GST, MBP) for selective purification.

  • Size exclusion chromatography: Separating the protein of interest from aggregates and contaminants based on molecular size.

  • Ion exchange chromatography: Separating proteins based on charge differences.

A typical purification workflow might include:

  • Cell lysis using mechanical methods or detergents

  • Initial clarification by centrifugation

  • Membrane fraction isolation if expressing in native form

  • Detergent solubilization

  • Sequential chromatography steps

  • Quality assessment using SDS-PAGE and western blotting

Researchers may need to optimize detergent type and concentration to balance protein extraction efficiency with retention of enzymatic activity.

How does CdsA function compare between virulent and attenuated Brucella strains?

Comparing CdsA function between virulent (e.g., B. abortus 2308, 9-941) and attenuated (e.g., S19) strains could provide insights into its role in virulence. Genome sequence analysis of the attenuated B. abortus vaccine strain S19 has identified several genes with consistent differences compared to virulent strains . While CdsA was not specifically mentioned among the 45 genes consistently different between attenuated and virulent strains in the provided search results, the methodology for such comparative analysis would involve:

  • Sequence alignment of cdsA genes from virulent and attenuated strains to identify potential mutations.

  • Expression and purification of CdsA from different strains.

  • Comparative enzymatic activity assays to evaluate functional differences.

  • Structural biology approaches to understand how mutations might affect enzyme function.

  • Complementation studies to determine if CdsA from virulent strains can restore virulence traits in attenuated strains.

Such studies could reveal whether alterations in phospholipid biosynthesis enzymes contribute to attenuation, similar to the identified differences in erythritol metabolism genes that affect virulence .

What role does CdsA play in Brucella's adaptation to intracellular environments?

Brucella abortus is an intracellular pathogen that must adapt to various microenvironments within host cells. CdsA, as a key enzyme in phospholipid biosynthesis, likely contributes to membrane adaptations required for intracellular survival. Research considerations should include:

  • Membrane remodeling: Investigating how CdsA activity changes during different stages of intracellular infection.

  • Nutrient acquisition: Examining how Brucella utilizes host-derived precursors for phospholipid synthesis, similar to its dependence on host-derived choline for phosphatidylcholine synthesis .

  • Stress response: Evaluating how phospholipid composition changes in response to intracellular stressors (pH, oxidative stress, nutrient limitation).

  • Brucella-containing vacuole (BCV) formation: Determining if CdsA-dependent phospholipids contribute to the formation and maintenance of the replicative niche.

Methodological approaches could include:

  • Conditional cdsA mutants to study essential gene function

  • Fluorescently tagged CdsA to track localization during infection

  • Lipidomic analysis of Brucella membrane composition during different infection stages

  • Transcriptomic and proteomic analyses to determine regulation of cdsA expression during infection

Can CdsA be targeted for novel therapeutic approaches against brucellosis?

Exploring CdsA as a therapeutic target would require several research considerations:

  • Essentiality assessment: Determining whether CdsA is essential for Brucella survival or virulence through conditional knockout studies.

  • Structural characterization: Resolving the enzyme's structure to identify potential binding sites for inhibitor design.

  • High-throughput screening: Developing assays suitable for screening compound libraries for CdsA inhibitors.

  • Comparative enzymology: Assessing differences between bacterial and host phospholipid biosynthesis enzymes to ensure selectivity.

  • In vivo validation: Testing promising inhibitors in cellular and animal models of infection.

This research direction is particularly promising considering the limited treatment options for brucellosis, which currently requires prolonged antibiotic treatment with relapse rates of 5-10% . Targeting enzymes involved in membrane phospholipid synthesis could provide alternative therapeutic approaches to conventional antibiotics.

What are the optimal conditions for biochemical characterization of recombinant CdsA?

For comprehensive biochemical characterization of recombinant CdsA, researchers should consider:

  • pH optimization: Testing enzyme activity across a pH range (typically 6.0-8.5) to determine optimal conditions.

  • Temperature dependence: Assessing activity at different temperatures to determine thermal optimum and stability.

  • Metal ion requirements: Evaluating the effects of different divalent cations (Mg²⁺, Mn²⁺, Ca²⁺) on enzyme activity.

  • Substrate specificity: Testing various phosphatidic acid species with different fatty acid compositions.

  • Kinetic parameters: Determining Km, Vmax, and kcat values for both substrates (phosphatidic acid and CTP).

Experimental setup should include:

  • Purified recombinant CdsA at defined concentration

  • Buffer systems with appropriate pH range

  • Temperature-controlled reaction vessels

  • Various metal ion cofactors

  • Range of substrate concentrations for kinetic analyses

Data analysis should include enzyme kinetics modeling to determine reaction mechanism and inhibition patterns.

How can genetic manipulation systems be optimized for studying cdsA function in Brucella?

Studying cdsA function in Brucella requires careful genetic manipulation approaches:

  • Conditional knockout strategies: Since CdsA may be essential, use of inducible promoters to control expression levels.

  • Site-directed mutagenesis: Creating specific mutations to study structure-function relationships.

  • Complementation systems: Reintroducing wild-type or mutant cdsA genes to rescue phenotypes.

  • Reporter fusions: Creating transcriptional or translational fusions to monitor expression and localization.

Considerations for optimal experimental design include:

  • Selection of appropriate antibiotic resistance markers

  • Use of suicide vectors for genomic integration

  • Design of homologous recombination regions

  • Construction of expression vectors with compatible origins of replication

  • Development of inducible systems that function in intracellular environments

These genetic tools would enable researchers to study how alterations in CdsA affect Brucella virulence traits similar to those observed with other phospholipid biosynthesis genes, such as pssA .

What experimental approaches can elucidate the relationship between phospholipid synthesis and Brucella virulence?

To investigate the relationship between CdsA-mediated phospholipid synthesis and Brucella virulence, researchers should consider:

  • Cellular infection models: Using macrophage and epithelial cell infection assays to assess intracellular survival of CdsA-modified strains.

  • Animal models: Evaluating the ability of CdsA-modified strains to establish infection in mouse models.

  • Transcriptomic analysis: Determining how alterations in phospholipid synthesis affect global gene expression.

  • Membrane integrity assays: Assessing how changes in phospholipid composition affect membrane permeability and resistance to environmental stresses.

  • Vacuole trafficking studies: Investigating the impact on Brucella-containing vacuole formation and trafficking.

Experimental design should include:

  • Conditional CdsA mutants or strains with altered CdsA activity

  • Appropriate controls including complemented strains

  • Time course experiments to track infection progression

  • Quantitative assays for bacterial survival and replication

  • Imaging techniques to visualize intracellular bacteria

These approaches would build upon previous studies showing that phospholipid composition is critical for Brucella's interaction with host cells .

What lipidomic approaches are recommended for studying CdsA-dependent phospholipid profiles?

For comprehensive analysis of phospholipid profiles in CdsA-studied systems:

  • Mass spectrometry-based approaches:

    • LC-MS/MS for detailed phospholipid species identification

    • MALDI-TOF for rapid phospholipid fingerprinting

    • Shotgun lipidomics for comprehensive lipidome analysis

  • Thin-layer chromatography (TLC):

    • One-dimensional or two-dimensional TLC for phospholipid class separation

    • Specific staining methods for different phospholipid classes

  • NMR spectroscopy:

    • ³¹P-NMR for phospholipid headgroup analysis

    • ¹H-NMR for fatty acid composition determination

  • Stable isotope labeling:

    • Using ¹³C or ³²P-labeled precursors to track phospholipid biosynthesis

    • Pulse-chase experiments to determine turnover rates

Data analysis should include:

  • Statistical comparison of phospholipid profiles between wild-type and CdsA-modified strains

  • Correlation of phospholipid changes with phenotypic outcomes

  • Integration with transcriptomic or proteomic datasets for systems-level understanding

How can structural studies of CdsA inform understanding of its catalytic mechanism?

Structural studies of Brucella abortus CdsA can provide valuable insights into its function:

  • X-ray crystallography:

    • Obtaining crystal structures of CdsA alone or with substrates/products

    • Identifying catalytic residues and substrate binding sites

  • Cryo-electron microscopy:

    • Determining structure of CdsA in native membrane environments

    • Visualizing conformational changes during catalysis

  • Molecular modeling:

    • Homology modeling based on related enzymes

    • Molecular dynamics simulations to understand protein flexibility

  • Mutagenesis coupled with activity assays:

    • Creating alanine scanning mutants to identify essential residues

    • Testing specific hypotheses about catalytic mechanism

These approaches would help researchers understand:

  • How CdsA recognizes diverse phosphatidic acid substrates

  • The mechanism of phosphodiester bond formation

  • Potential allosteric regulation sites

  • Structural differences between bacterial and mammalian enzymes that could be exploited for drug design

What bioinformatic approaches can identify conserved features of CdsA across Brucella species?

Bioinformatic analysis of CdsA across Brucella species can provide evolutionary insights:

  • Sequence alignment and phylogenetic analysis:

    • Multiple sequence alignment of CdsA from different Brucella species

    • Construction of phylogenetic trees to understand evolutionary relationships

    • Identification of conserved domains and catalytic residues

  • Structural prediction and comparison:

    • Homology modeling of CdsA from different species

    • Comparison of predicted structures to identify conserved structural features

    • Docking studies with substrates to predict binding modes

  • Genomic context analysis:

    • Examining organization of phospholipid biosynthesis genes in different species

    • Identifying potential operon structures and regulatory elements

    • Comparing with related alpha-proteobacteria

  • Comparative analysis with virulent and attenuated strains:

    • Systematic comparison similar to that performed for other genes in the S19 strain

    • Identification of consistent differences that may contribute to virulence

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.