Recombinant Brucella abortus Probable ABC transporter permease protein BAB2_0490 (BAB2_0490)

Shipped with Ice Packs
In Stock

Description

Functional Insights

ABC transporters in Brucella are implicated in nutrient uptake, virulence, and stress resistance. While BAB2_0490’s specific substrate remains uncharacterized, homologs in related pathogens suggest roles in:

  • Metal ion transport (e.g., iron or manganese acquisition)

  • Antimicrobial resistance via efflux mechanisms

  • Host-pathogen interaction through membrane protein interactions

Notably, Brucella ABC transporters like Omp19 and Fe/Mn SOD are critical for evading host proteases and oxidative stress, respectively .

Antigen Production

  • Used in ELISA and Western blot assays to detect Brucella-specific antibodies .

  • Serves as a control protein in proteomic studies comparing Brucella species .

Vaccine Development

  • Potential inclusion in multi-antigen formulations (e.g., combined with Omp16, Omp19, L7/L12) to enhance protection .

Challenges and Future Directions

  • Functional Validation: Mechanistic studies are needed to confirm BAB2_0490’s role in virulence or nutrient transport.

  • Immunogenicity Testing: Preclinical trials in murine models could assess its capacity to induce IFN-γ or CD8+ T cell responses .

  • Thermostability Optimization: Lyophilized formulations require stability testing under diverse conditions .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preferred format in the order notes and we will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize its development.
Synonyms
BAB2_0490; Probable ABC transporter permease protein BAB2_0490
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-289
Protein Length
full length protein
Species
Brucella abortus (strain 2308)
Target Names
BAB2_0490
Target Protein Sequence
MQNRTLPYFLILPSLLLAAVVIFWPVVHLFEIATHDVNRFGQLREFNDGANFTALFATAE FMNALWRTAVWTVAVVGGALVLSIPVAIILNMDFYGRSVARVIIMLPWAVSLTMTAIFWR WALNGESGMLNSALHGLGLIDTNIQWLASAATAFPMQILVGILVTVPFTTTIFLGGLSSI PDDLYEASSLEGASLWQQFREITFPLLKPFVNIAIVLNTIYVFNSFPIIWVMTQGRPANS TDILVTHLYKLAFRLGKFGEASAVSLIMLAILLVFTVIYIRISTRSEQS
Uniprot No.

Target Background

Function
This protein is likely a component of an ABC transporter complex. It is probably responsible for the translocation of the substrate across the membrane.
Database Links
Protein Families
Binding-protein-dependent transport system permease family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How is recombinant BAB2_0490 protein produced for research applications?

For research applications, recombinant BAB2_0490 is typically produced using heterologous expression in E. coli. The full-length protein (amino acids 1-289) is fused to an N-terminal His-tag to facilitate purification through affinity chromatography . The expression system allows for the production of sufficient quantities of protein for biochemical and structural studies. The recombinant protein is commonly provided as a lyophilized powder that requires reconstitution before experimental use .

What are the optimal storage and handling protocols for recombinant BAB2_0490?

Optimal storage and handling of recombinant BAB2_0490 requires careful attention to temperature and buffer conditions to maintain protein integrity. The following protocol is recommended:

ParameterRecommended Condition
Long-term storage-20°C/-80°C with aliquoting to prevent freeze-thaw cycles
Storage bufferTris/PBS-based buffer with 6% Trehalose, pH 8.0
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL
Stability enhancer5-50% glycerol (final concentration)
Working storage4°C for up to one week
Pre-use preparationBrief centrifugation to bring contents to bottom of vial

Repeated freeze-thaw cycles should be strictly avoided as they can significantly compromise protein stability and function .

What expression systems have been validated for BAB2_0490 production?

While E. coli remains the predominant expression system for BAB2_0490, researchers should consider that membrane proteins often present challenges in heterologous expression. The commercial recombinant BAB2_0490 is produced in E. coli with an N-terminal His-tag, yielding protein with greater than 90% purity as determined by SDS-PAGE . For researchers developing their own expression protocols, optimizing induction conditions (temperature, inducer concentration, and duration) and considering specialized E. coli strains designed for membrane protein expression (such as C41/C43) may improve yield and solubility.

How can subcellular localization of BAB2_0490 be experimentally determined?

Determining the precise subcellular localization of BAB2_0490 requires rigorous fractionation and detection methodologies. Based on approaches used for similar Brucella membrane proteins, the following protocol is recommended:

  • Generate a tagged version of BAB2_0490 (e.g., 3×FLAG-tagged) through chromosomal integration to maintain native expression levels.

  • Fractionate bacterial cells using established protocols for separating cytoplasmic, periplasmic, and membrane compartments.

  • Validate fractionation quality using control proteins specific to each compartment:

    • Anti-GroEL antibody for cytoplasmic fraction

    • Anti-SodC antibody for periplasmic fraction

    • Anti-Omp89 antibody for membrane fraction

  • Detect BAB2_0490 using anti-FLAG antibody in Western blot analysis of each fraction.

Similar approaches with other Brucella membrane proteins have demonstrated that transmembrane proteins containing alpha-helical structures predominantly localize to membrane fractions, as would be expected for BAB2_0490 based on its sequence properties .

What experimental approaches can elucidate the functional role of BAB2_0490 in Brucella pathogenesis?

To investigate the functional significance of BAB2_0490 in Brucella pathogenesis, a multi-faceted experimental approach is recommended:

  • Gene deletion analysis: Generate precise, non-polar deletion mutants (ΔBAB2_0490) to assess phenotypic changes in:

    • Growth kinetics in standard and stress conditions

    • Intracellular survival within macrophages

    • Virulence in mouse infection models

    • Resistance to environmental stressors

  • Expression profiling: Analyze BAB2_0490 expression under conditions relevant to infection:

    • Stationary versus logarithmic growth phases

    • Oxidative stress (H₂O₂ exposure)

    • Acidic pH (mimicking phagolysosomal environment)

    • Nutrient limitation (minimal media)

  • Complementation studies: Reintroduce BAB2_0490 into deletion mutants to confirm phenotype restoration, ideally using both native and controlled expression systems to assess dose-dependent effects.

  • In vivo colonization: Compare spleen colonization capabilities between wild-type and ΔBAB2_0490 mutants in BALB/c mice, using approaches similar to those documented for other Brucella virulence factors .

How does BAB2_0490 relate to the broader ABC transporter systems in Brucella abortus?

BAB2_0490 should be analyzed in the context of the complete ABC transporter system in which it functions. ABC transporters typically consist of four domains: two nucleotide-binding domains (NBDs) that bind and hydrolyze ATP, and two transmembrane domains (TMDs) that form the substrate translocation pathway.

As a permease protein, BAB2_0490 likely functions as one of the TMDs in its ABC transporter complex. To characterize its role within this system:

  • Identify genes encoding putative partner components:

    • The complementary TMD (if the transporter is a heterodimer)

    • The associated NBDs

    • The substrate-binding protein (SBP) that determines substrate specificity

  • Analyze genomic organization to determine if BAB2_0490 is encoded within an operon containing other transporter components.

  • Perform co-expression and co-immunoprecipitation studies to identify physical interactions between BAB2_0490 and other components.

  • Compare functional characteristics with similar systems such as the putative fucose transport system described in Brucella (BAB1_0238 to BAB1_0248), which shows regulated expression in response to substrate availability .

What mechanisms regulate BAB2_0490 expression under different environmental conditions?

Understanding the regulatory mechanisms controlling BAB2_0490 expression requires systematic analysis under various conditions. Based on regulatory patterns observed for other Brucella membrane proteins:

  • Transcriptional profiling: Analyze BAB2_0490 transcript levels using Northern blot or qRT-PCR under:

    • Different growth phases (log vs. stationary)

    • Stress conditions (oxidative, acid, nutrient limitation)

    • Host-mimicking environments

  • Promoter analysis: Characterize the promoter region of BAB2_0490 to identify:

    • Transcription start sites

    • Regulatory elements

    • Binding sites for transcription factors

  • Transcriptional regulator identification: Investigate potential regulators such as:

    • LysR-type transcriptional regulators (LTTRs) similar to VtlR, which has been shown to regulate other membrane proteins in Brucella

    • Two-component systems responsive to environmental stimuli

    • Global regulators of stress response or virulence

  • Reporter gene assays: Construct promoter-reporter fusions to monitor BAB2_0490 expression in real-time under various conditions.

Studies of similar Brucella proteins have revealed complex regulation patterns, with some proteins showing increased expression during stationary phase, under oxidative stress, and in acidic conditions .

What methodologies can identify the substrate specificity of the ABC transporter containing BAB2_0490?

Determining substrate specificity of the ABC transporter system containing BAB2_0490 requires a combination of genetic, biochemical, and computational approaches:

  • Comparative genomics: Analyze sequence similarity with characterized ABC transporters to predict substrate class (e.g., sugars, amino acids, peptides, ions).

  • Growth phenotyping: Test growth of wild-type and ΔBAB2_0490 mutants with various sole carbon or nitrogen sources to identify potential substrates.

  • Transport assays: Perform radiolabeled or fluorescently-labeled substrate uptake experiments comparing wild-type and mutant strains.

  • Expression analysis: Monitor changes in BAB2_0490 expression in response to potential substrates, similar to the approach used to identify the Brucella fucose transport system .

  • Substrate-binding protein characterization: If the associated substrate-binding protein can be identified, perform:

    • In vitro binding assays with potential substrates

    • Thermal shift assays to identify ligands that stabilize protein structure

    • Crystallography studies to determine binding pocket architecture

  • Metabolomic analysis: Compare intracellular and extracellular metabolite profiles between wild-type and mutant strains to identify accumulated or depleted compounds.

What are the critical considerations for designing gene knockout experiments targeting BAB2_0490?

Successful gene knockout studies require careful design to ensure specificity and minimize unintended effects:

  • Deletion strategy selection:

    • In-frame deletion to prevent polar effects on downstream genes

    • Complete ORF removal while preserving regulatory elements

    • Marker-less deletion systems for clean genetic manipulation

  • Construct design:

    • Include 500-1000 bp homologous flanking regions

    • Carefully design junction points to prevent creation of novel ORFs

    • Consider codon usage and potential translational coupling

  • Confirmation methods:

    • PCR verification with primers outside the deletion region

    • RT-PCR to confirm absence of transcript

    • Western blot or proteomics to confirm protein absence

    • Genome sequencing to rule out secondary mutations

  • Complementation strategy:

    • Reintroduce gene under native promoter

    • Consider inducible systems for dose-dependent studies

    • Utilize neutral integration sites for chromosomal complementation

  • Control strains:

    • Wild-type parent strain

    • Complemented mutant strain

    • Related gene deletion for specificity assessment

This approach aligns with methodologies successfully employed for other Brucella membrane proteins, where targeted gene deletions have revealed functional insights without disrupting expression of adjacent genes .

How should researchers optimize purification protocols for recombinant BAB2_0490?

Purification of membrane proteins like BAB2_0490 presents unique challenges requiring specialized approaches:

  • Membrane extraction optimization:

    Detergent ClassExamplesAdvantagesConsiderations
    NonionicDDM, Triton X-100Mild, maintain native structureMay be insufficient for tight membrane association
    ZwitterionicCHAPS, LDAOEffective solubilizationMay destabilize some protein complexes
    IonicSDS, SarkosylHigh extraction efficiencyOften denaturing
  • Purification strategy:

    • Initial IMAC (immobilized metal affinity chromatography) using His-tag

    • Secondary purification via size exclusion chromatography

    • Consider ion exchange chromatography for additional purity

  • Stability optimization:

    • Screen buffer compositions (pH, salt concentration, additives)

    • Evaluate detergent exchange during purification

    • Consider lipid addition to stabilize native structure

    • Test protein stabilizing agents (glycerol, specific ions)

  • Quality assessment:

    • SDS-PAGE for purity evaluation

    • Dynamic light scattering for homogeneity assessment

    • Circular dichroism for secondary structure verification

    • Activity assays if applicable

  • Alternative approaches:

    • Nanodiscs or amphipols for detergent-free stabilization

    • Styrene maleic acid copolymer (SMA) extraction to maintain lipid environment

What experimental approaches can determine the topology of BAB2_0490 in the bacterial membrane?

Determining membrane protein topology is crucial for understanding structure-function relationships:

  • Computational prediction:

    • Transmembrane helix prediction algorithms (TMHMM, Phobius)

    • Topology consensus from multiple tools

    • Hydropathy plot analysis

  • Experimental validation:

    • Reporter fusion approach:

      • Generate fusions with reporters (PhoA, LacZ, GFP) at various positions

      • PhoA is active when located in periplasm

      • LacZ is active when located in cytoplasm

      • Analyze activity patterns to map membrane-spanning regions

    • Cysteine accessibility method:

      • Introduce cysteine residues at strategic positions

      • Assess accessibility to membrane-impermeant sulfhydryl reagents

      • Map exposed versus embedded residues

    • Protease protection assays:

      • Treat spheroplasts with proteases

      • Identify protected fragments by mass spectrometry

      • Map regions exposed to cytoplasm or periplasm

  • Structural approaches:

    • Cryo-electron microscopy

    • X-ray crystallography (challenging for membrane proteins)

    • NMR spectroscopy for dynamic information

How can researchers investigate potential interactions between BAB2_0490 and other bacterial proteins?

Understanding protein-protein interactions is essential for elucidating BAB2_0490's functional network:

  • In vivo approaches:

    • Bacterial two-hybrid assays

    • Protein complementation assays (split-GFP, DHFR)

    • Förster resonance energy transfer (FRET)

    • In vivo crosslinking followed by mass spectrometry

  • Co-purification strategies:

    • Co-immunoprecipitation with tagged BAB2_0490

    • Pull-down assays with recombinant BAB2_0490

    • Tandem affinity purification

    • Blue native PAGE to preserve native complexes

  • Library screening methods:

    • Yeast two-hybrid screening against Brucella genomic libraries

    • Phage display screening

    • Protein array analysis

  • Bioinformatic prediction:

    • Genomic context analysis (gene neighborhood, fusion events)

    • Co-evolution analysis

    • Structural modeling of potential interactions

These approaches would help identify whether BAB2_0490 interacts with other components of its ABC transporter complex or with additional bacterial proteins involved in membrane organization, stress response, or virulence.

How might BAB2_0490 contribute to Brucella abortus virulence and host adaptation?

As a membrane transport protein, BAB2_0490 may play significant roles in bacterial adaptation to the host environment:

  • Nutrient acquisition: ABC transporters often facilitate uptake of essential nutrients that may be limited in host environments. Characterizing substrate specificity could reveal links to metabolic pathways essential during infection.

  • Stress adaptation: Transport systems can contribute to stress resistance by maintaining homeostasis or exporting toxic compounds. Similar to findings with other Brucella proteins, BAB2_0490 expression might be upregulated under oxidative stress or acidic conditions encountered within macrophages .

  • Host-pathogen interface: Some bacterial transporters are involved in secretion of virulence factors or modulation of host responses.

  • Antimicrobial resistance: ABC transporters can contribute to antibiotic resistance through efflux mechanisms.

Research approaches should include:

  • Comparative transcriptomics of wild-type and ΔBAB2_0490 strains during macrophage infection

  • Metabolomic profiling during infection

  • Assessment of sensitivity to host antimicrobial factors

  • Mouse infection studies with tissue-specific analyses

What therapeutic potential exists in targeting BAB2_0490 or its associated transport system?

Bacterial transport systems represent attractive therapeutic targets due to their accessibility and essential functions:

  • Inhibitor development strategy:

    • High-throughput screening against recombinant BAB2_0490

    • Structure-based drug design if structural data becomes available

    • Peptidomimetic approaches targeting transmembrane interfaces

    • Virtual screening using computational models

  • Target validation approaches:

    • Demonstrate essentiality under infection-relevant conditions

    • Assess conservation across Brucella species and strains

    • Evaluate specificity relative to host transporters

    • Determine effects of chemical inhibition on bacterial survival

  • Combination approaches:

    • Pairing transporter inhibitors with conventional antibiotics

    • Targeting multiple components of the transport system simultaneously

    • Exploiting the transporter for "Trojan horse" delivery of antimicrobials

  • Vaccine development considerations:

    • Evaluate BAB2_0490 as a potential antigenic component

    • Assess membrane exposure and immunogenicity

    • Consider attenuated strains with modified transport capacity

How can systems biology approaches integrate BAB2_0490 into broader understanding of Brucella pathogenesis?

Integrating BAB2_0490 research into systems-level analyses can provide comprehensive insights into Brucella pathogenesis:

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Map BAB2_0490 to relevant metabolic and virulence networks

    • Identify regulatory networks controlling expression

  • Comparative genomics:

    • Analyze conservation and evolution across Brucella species

    • Compare with homologs in other pathogens

    • Identify strain-specific variations that may correlate with virulence

  • Host-pathogen interaction modeling:

    • Incorporate BAB2_0490 function into computational models of infection

    • Predict metabolic adaptations during host colonization

    • Model effects of transporter inhibition on bacterial fitness

  • Synthetic biology applications:

    • Engineer modified transporters with altered substrate specificity

    • Develop biosensors based on transport function

    • Create attenuated strains with controlled expression

This systems approach would position BAB2_0490 research within the broader context of bacterial physiology and pathogenesis, potentially revealing unexpected connections to established virulence mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.