Recombinant Brucella abortus Probable ABC transporter permease protein BAB2_1148 (BAB2_1148)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
BAB2_1148; Probable ABC transporter permease protein BAB2_1148
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-250
Protein Length
full length protein
Species
Brucella abortus (strain 2308)
Target Names
BAB2_1148
Target Protein Sequence
MNARLTGLGLNLLSFAVGIGGWYLLTATGAVVLPGPVDVLERAVTLLLNGQLVGDIFASL RRVLSGFVLGVALAIPVGFLMGWYRIARSLIEPWVQFFRMIPPLAVIPLAIVTLGIDESP KIFVIFLASFLSSVVATYQGVISVDRTLINAARVLGAKDATIFARVIVPASVPFILVGVR IGLGSAWATVVAAELIAAQSGLGYRMQQAQLYYDLPTIFVSLVTIGILGLFMDRLLQAAD RRLTQWQERA
Uniprot No.

Target Background

Function
This protein is likely part of an ABC transporter complex. It is probably responsible for the translocation of the substrate across the membrane.
Database Links
Protein Families
Binding-protein-dependent transport system permease family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is BAB2_1148 and what is its role in Brucella abortus?

BAB2_1148 is a probable ABC transporter permease protein found in Brucella abortus, a pathogenic bacterium responsible for brucellosis. This membrane protein belongs to the ABC (ATP-binding cassette) transporter family, which plays crucial roles in nutrient acquisition and cellular homeostasis. ABC transporters typically consist of a substrate-binding protein, a permease component (which BAB2_1148 represents), and an ATP-binding protein that provides energy for transport . In Brucella species, ABC transporters are involved in critical cellular functions including nutrient uptake, which supports bacterial survival and replication within host cells.

The protein consists of 250 amino acids with a sequence that suggests multiple transmembrane domains characteristic of permease components, allowing it to form a channel through which substrates can pass across the cell membrane . While the specific substrates of BAB2_1148 have not been definitively characterized in the provided research, studies on homologous ABC transporters in Brucella suggest they may be involved in amino acid transport, which is crucial for intracellular survival and virulence.

How does BAB2_1148 differ from other ABC transporters in Brucella species?

BAB2_1148 differs from other Brucella ABC transporters primarily in its amino acid sequence and likely in substrate specificity. The protein has a distinctive amino acid sequence (MNARLTGLGLNLLSFAVGIGGWYLLTATGAVVLPGPVDVLERAVTLLLNGQLVGDIFASLRRVLSGFVLGVALAIPVGFLMGWYRIARSLIEPWVQFFRMIPPLAVIPLAIVTLGIDESPKIFVIFLASFLSSVVATYQGVISVDRTLINAARVLGAKDATIFARVIVPASVPFILVGVRIGLGSAWATVVAAELIAAQSGLGYRMQQAQLYYDLPTIFVSLVTIGILGLFMDRLLQAADRRLTQWQERA) that influences its structure and function .

While some ABC transporters in Brucella, such as the amino acid ABC transporter encoded by bab_RS27735 (also known as aapJ2), are directly implicated in virulence and intracellular survival, the specific role of BAB2_1148 in pathogenesis hasn't been as thoroughly characterized in the available research . The bab_RS27735-encoded transporter has been shown to be essential for early infection stages in a mouse model, with deletion mutants showing reduced survival within macrophages. This suggests functional specialization among different ABC transporters in Brucella, with each potentially contributing to different aspects of bacterial physiology and virulence .

What structural features characterize the BAB2_1148 protein?

The BAB2_1148 protein exhibits several key structural features typical of ABC transporter permease components. Based on its amino acid sequence, the protein likely contains multiple transmembrane domains that anchor it within the bacterial cell membrane and form a channel for substrate translocation . The protein consists of 250 amino acids with a predicted molecular weight that allows it to be effectively expressed and purified as a recombinant protein for research applications.

Structural analysis suggests BAB2_1148 contains hydrophobic regions consistent with membrane-spanning domains, as well as more hydrophilic regions that likely participate in substrate recognition and binding. While detailed crystallographic data is not provided in the available research, computational predictions based on the amino acid sequence suggest the protein adopts a conformation with several membrane-spanning α-helices, connected by loop regions that may be involved in substrate specificity or interactions with other components of the ABC transporter complex . These structural features are essential for the protein's function in facilitating the movement of specific substrates across the bacterial membrane.

What are the recommended protocols for expressing and purifying recombinant BAB2_1148 protein?

Expression and purification of recombinant BAB2_1148 protein requires careful optimization due to its membrane-associated nature. Based on established methodologies for similar proteins, researchers should consider the following protocol:

First, select an appropriate expression system. While E. coli is commonly used, membrane proteins may require specialized strains like C41(DE3) or C43(DE3) that are adapted for membrane protein expression. Clone the BAB2_1148 gene into an expression vector containing a strong inducible promoter (T7 or tac) and an appropriate affinity tag (His6, GST, or MBP) to facilitate purification. The tag choice is critical - a His6 tag is commonly used but may affect protein folding, while larger tags like MBP can enhance solubility.

For expression, grow transformed cells to mid-log phase (OD600 of 0.6-0.8) at 37°C, then induce with IPTG at reduced concentrations (0.1-0.5 mM) and lower temperatures (16-25°C) to prevent inclusion body formation. Extend expression time to 16-20 hours for optimal yield. Harvest cells by centrifugation and prepare membrane fractions through sonication followed by ultracentrifugation.

For purification, solubilize the membrane fraction using appropriate detergents like n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) at concentrations above their critical micelle concentration. Purify using affinity chromatography based on the selected tag, followed by size exclusion chromatography to enhance purity. The resulting protein should be stored in buffer containing 50% glycerol at -20°C for short-term or -80°C for long-term storage to maintain stability .

How can researchers effectively design knockout studies to investigate BAB2_1148 function?

To effectively design knockout studies investigating BAB2_1148 function, researchers should implement a comprehensive strategy based on established methodologies demonstrated with similar genes in Brucella. The following methodological approach is recommended:

First, construct a deletion vector containing upstream and downstream homologous regions flanking the BAB2_1148 gene, with an antibiotic resistance marker (typically kanamycin or gentamicin) inserted between these regions. The homologous regions should be approximately 500-1000 bp in length to ensure efficient recombination. Transform this construct into Brucella abortus using electroporation, with parameters optimized for Brucella (typically 2.5 kV, 25 μF, 400 Ω).

Select transformants on media containing appropriate antibiotics, then verify deletion through PCR using primers that bind outside the homologous regions. Confirmation should include both positive verification of the antibiotic resistance gene and negative verification showing absence of the BAB2_1148 gene. Further verification via Southern blot or whole-genome sequencing is advisable to confirm single-site integration and absence of unintended mutations.

Phenotypic characterization should include growth curve analysis in standard media and under stress conditions (nutrient limitation, pH variation), intracellular survival assays in macrophage cell lines (RAW264.7 or J774), and virulence assessment in a mouse model tracking bacterial load in spleen and liver at multiple timepoints (2, 4, 8, and 12 weeks post-infection). Additionally, co-localization studies using confocal microscopy with LAMP-1 markers can determine if the mutant maintains the ability to avoid lysosomal fusion within host cells .

What cell culture systems are most appropriate for studying BAB2_1148 function in host-pathogen interactions?

For studying BAB2_1148 function in host-pathogen interactions, several cell culture systems offer complementary advantages. The most appropriate systems include:

Macrophage cell lines represent the primary choice, with RAW264.7 murine macrophages being the gold standard for Brucella infection studies. These cells readily phagocytose bacteria and support the complete intracellular life cycle of Brucella. J774A.1 macrophages provide an alternative with similar properties. For infection assays, maintain cells in DMEM with 10% FBS, infect at MOI 50-100, centrifuge briefly (200 × g, 5 min) to synchronize infection, and incubate for 45-60 minutes before washing and adding gentamicin (50 μg/ml) to kill extracellular bacteria .

Epithelial cell lines, particularly HeLa cells, offer insights into non-professional phagocyte interactions. While less commonly infected in vivo, these cells provide clearer visualization of intracellular trafficking due to their flatter morphology. Trophoblast cell lines (e.g., BeWo or JAr) are particularly relevant when studying Brucella's placental tropism, which relates to its characteristic induction of abortion in mammalian hosts.

Primary cells isolated from mice, cattle, or goats provide the most physiologically relevant system but present technical challenges. Bone marrow-derived macrophages (BMDMs) from mice offer a good compromise between relevance and technical feasibility. For BMDMs, harvest bone marrow from femurs and tibias of mice, culture in RPMI with 10% FBS and M-CSF (20 ng/ml) for 7 days, then proceed with infection as described for cell lines .

What interactions occur between BAB2_1148 and host immune responses during infection?

The interactions between BAB2_1148 and host immune responses represent a complex relationship likely involving both direct and indirect mechanisms. Based on studies of homologous ABC transporters in Brucella, several key interaction patterns emerge.

ABC transporters may influence cytokine production patterns during infection. Research on related transporter mutants showed altered cytokine profiles, particularly regarding IFN-γ and TNF-α levels, compared to wild-type infections. For instance, deletion of the amino acid ABC transporter gene bab_RS27735 altered the release of IL-12p40 and TNF-α into peripheral blood of infected mice . This suggests that ABC transporters may modulate the host inflammatory response, potentially through alterations in bacterial surface components or secreted factors that interact with host immune receptors.

Deletion mutants of ABC transporters have shown altered expression profiles of other virulence genes, including those involved in flagellar synthesis. For example, deletion of bab_RS27735 up-regulated flagellar synthesis-related genes (bab_RS26930 and bab_RS31530) . Since flagellar components are recognized by pattern recognition receptors of the innate immune system, this indirect effect may enhance immune recognition of the bacterium, potentially contributing to attenuated virulence through increased immune clearance.

Additionally, the metabolic consequences of ABC transporter dysfunction likely affect host-pathogen interactions. Nutrient limitation resulting from impaired transporter function may trigger stress responses in the bacterium that alter its immunogenic profile. These metabolic adaptations could potentially expose additional pathogen-associated molecular patterns (PAMPs) to host immune surveillance, increasing recognition by innate immune mechanisms.

What is the relationship between BAB2_1148 and other virulence factors in Brucella abortus?

The relationship between BAB2_1148 and other virulence factors in Brucella abortus involves complex regulatory networks and functional interactions that collectively determine the bacterium's pathogenic potential. From available research on ABC transporters in Brucella, several key relationships can be inferred:

ABC transporters like BAB2_1148 appear to have both direct effects on bacterial physiology and indirect effects on expression of other virulence factors. Deletion of the related ABC transporter gene bab_RS27735 led to up-regulation of diverse genes, suggesting possible compensatory responses or relief from negative regulation . This indicates potential regulatory cross-talk between different virulence systems, where altered function of one component triggers adjustments in others to maintain pathogenic capacity.

The temporal dynamics of infection provide important insights into these relationships. Studies with the bab_RS27735 deletion mutant showed attenuated virulence early in infection but recovered virulence at later stages . This suggests that different virulence factors assume primary importance at different infection stages, with ABC transporters potentially being most critical during initial adaptation to the intracellular environment, while other factors become dominant during persistent infection phases.

From a functional perspective, BAB2_1148 likely works in concert with the Type IV Secretion System (T4SS), a major virulence determinant in Brucella. While ABC transporters facilitate nutrient acquisition, the T4SS delivers effector molecules that modulate host cell functions. This complementary relationship may be essential for successful intracellular replication – the transporter ensures metabolic sufficiency while the T4SS creates a hospitable replication niche by manipulating host cellular processes.

How do recombinant BAB2_1148 proteins compare with other ABC transporter proteins as potential vaccine candidates?

When evaluating recombinant BAB2_1148 proteins as potential vaccine candidates compared to other ABC transporter proteins, several important considerations emerge from immunological and functional perspectives.

ABC transporters possess several characteristics that make them promising vaccine targets. As membrane-associated proteins with surface-exposed domains, they are potentially accessible to antibodies, making them suitable candidates for vaccine development. Research on related transporters suggests they can elicit protective immune responses. For instance, studies indicate that ABC transporters in Brucella are involved in modulating host immune responses, with some showing the ability to affect cytokine production patterns, including IFN-γ levels . This immunomodulatory capacity could be leveraged in vaccine design.

From a functional standpoint, the role of ABC transporters in virulence makes them particularly attractive targets. Deletion mutants of the related bab_RS27735 ABC transporter showed attenuated virulence in early infection stages, suggesting that neutralizing antibodies against these transporters might impair bacterial survival within host cells . This connects directly to protection mechanisms, as limiting intracellular survival is a key goal of brucellosis vaccines.

What comparative analysis methods are most effective for studying the evolutionary conservation of BAB2_1148 across Brucella species?

For studying the evolutionary conservation of BAB2_1148 across Brucella species, researchers should employ a multi-faceted comparative analysis approach combining several complementary methodologies:

Sequence-based phylogenetic analysis provides the foundation for evolutionary studies of BAB2_1148. Researchers should collect homologous sequences from all available Brucella genomes, including both classical and atypical species, as well as closely related genera like Ochrobactrum. Multiple sequence alignment using MUSCLE or MAFFT algorithms optimized for transmembrane proteins is recommended, followed by phylogenetic tree construction using both Maximum Likelihood (RAxML or IQ-TREE) and Bayesian inference (MrBayes) methods with appropriate evolutionary models for membrane proteins. Bootstrap analysis (>1000 replicates) should be performed to assess branch support.

Selective pressure analysis using methods like PAML or HyPhy can identify signatures of positive or purifying selection by calculating nonsynonymous to synonymous substitution ratios (dN/dS) across the protein sequence. This approach can pinpoint specific amino acid positions under evolutionary pressure, potentially identifying functionally critical residues that could represent conserved epitopes suitable for vaccine design or drug targeting.

Structural conservation analysis using homology modeling tools like SWISS-MODEL or I-TASSER can predict three-dimensional structures based on known ABC transporter structures, allowing visualization of conserved domains and evaluation of structural impacts of sequence variations. Molecular dynamics simulations can further assess how sequence variations might affect protein flexibility and function across species.

The most effective comparative analysis incorporates both genomic context and functional data. Synteny analysis examining conservation of gene neighborhood provides insights into potential operon structures and coevolution of functionally related genes. Integration of transcriptomic data across species can reveal conservation of expression patterns, particularly during infection, indicating functional conservation despite sequence variations.

What are the implications of BAB2_1148 research for developing novel antibacterial strategies against Brucella infections?

Research into BAB2_1148 and related ABC transporters opens several promising avenues for developing novel antibacterial strategies against Brucella infections, with significant implications for both therapeutic and preventive approaches.

ABC transporters like BAB2_1148 represent attractive drug targets due to their essential roles in bacterial physiology and virulence. The membrane-associated nature of these proteins makes them potentially accessible to small molecule inhibitors without requiring intracellular penetration. Structure-based drug design targeting BAB2_1148 could yield specific inhibitors that block substrate transport, potentially starving the bacterium of essential nutrients within the host cell environment. Given the reduction in intracellular survival observed in ABC transporter mutants, such inhibitors might significantly impair the bacterium's ability to establish persistent infection .

From an immunological perspective, recombinant BAB2_1148 and related proteins show promise as components of subunit vaccines. Studies on virulence-associated proteins in Brucella have identified several that modulate host immune responses, suggesting that vaccines incorporating these antigens might elicit protective immunity . A particularly interesting approach would be developing epitope-based vaccines targeting conserved, surface-exposed regions of BAB2_1148 that are essential for function yet accessible to antibodies or T-cell recognition.

The stage-specific importance of ABC transporters in Brucella virulence, as demonstrated with related transporters like bab_RS27735, suggests potential for developing treatment strategies tailored to different infection phases . Early infection might be more effectively targeted through ABC transporter inhibition, while alternative targets might prove more effective for clearing established infections. This finding argues for combination therapies addressing multiple virulence mechanisms simultaneously.

What are the primary technical challenges in studying BAB2_1148 function, and how can they be addressed?

Studying BAB2_1148 function presents several technical challenges inherent to membrane protein research, requiring specialized approaches for comprehensive functional characterization.

The hydrophobic nature of membrane proteins like BAB2_1148 creates significant expression and purification difficulties. These proteins often misfold or aggregate when overexpressed, and their extraction requires detergents that can affect native structure and function. To address these challenges, researchers should employ expression systems specifically optimized for membrane proteins, such as C41(DE3) or C43(DE3) E. coli strains, which have adapted to accommodate membrane protein overexpression. Expression conditions should be carefully optimized, with lower temperatures (16-20°C) and reduced inducer concentrations. For purification, mild detergents like DDM or LMNG better preserve protein structure compared to more harsh alternatives like SDS. Native nanodiscs or styrene-maleic acid lipid particles (SMALPs) represent emerging alternatives that maintain proteins in a lipid environment, potentially preserving native function .

Functional characterization presents another major challenge. Traditional transport assays for ABC transporters involve reconstitution into liposomes and monitoring substrate movement, which is technically demanding and difficult to interpret. Researchers should consider alternative approaches such as ATPase activity assays as a proxy for transport function, or fluorescence-based binding assays to identify potential substrates. Complementation studies in deletion mutants represent a powerful approach, where restoration of wild-type phenotypes upon expression of BAB2_1148 can confirm function. Additionally, bacterial two-hybrid or pull-down assays can identify interaction partners, providing insights into functional networks .

The pathogenic nature of Brucella abortus necessitates biosafety level 3 (BSL-3) facilities for many experiments, restricting access and increasing experimental complexity. Where possible, researchers should consider surrogate models, such as the closely related but less pathogenic Brucella neotomae or the related genus Ochrobactrum, for initial screening experiments. Alternatively, heterologous expression in more tractable organisms like E. coli can provide preliminary functional insights before confirmation in Brucella .

How can researchers overcome stability issues when working with recombinant BAB2_1148 protein?

Overcoming stability issues with recombinant BAB2_1148 protein requires a multifaceted approach addressing both intrinsic membrane protein instability and experimental handling challenges.

Optimizing buffer conditions is fundamental to protein stability. For BAB2_1148, a Tris-based buffer system with glycerol (typically 50%) is recommended based on established protocols . Glycerol serves as a chemical chaperone that prevents aggregation and protects protein structure during freeze-thaw cycles. Researchers should systematically test buffer components including pH (7.0-8.0), salt concentration (100-500 mM NaCl), and additives such as glycerol (10-50%) to identify optimal stability conditions. Reducing agents like DTT or TCEP (1-5 mM) may improve stability by preventing oxidation of cysteine residues. Additionally, including specific lipids that match the native membrane environment can significantly enhance stability of membrane proteins.

Detergent selection critically influences membrane protein stability. While DDM is commonly used, newer detergents like GDN (glyco-diosgenin) or LMNG (lauryl maltose neopentyl glycol) often provide superior stability. A detergent screening approach using differential scanning fluorimetry can identify optimal detergents for BAB2_1148 stability. Alternatively, amphipols or nanodiscs represent detergent-free systems that often improve membrane protein stability by providing a more native-like environment. For BAB2_1148, researchers should consider MSP1D1 nanodiscs with a mixture of POPC/POPG lipids, which have shown success with other bacterial transporters.

Storage and handling protocols significantly impact stability. Aliquoting the purified protein into single-use volumes minimizes freeze-thaw cycles, each of which can cause substantial activity loss. Storage at -80°C is preferable for long-term preservation, while short-term storage at -20°C is acceptable if the buffer contains 50% glycerol . For experiments requiring room temperature handling, addition of protease inhibitors (PMSF, EDTA, or commercial cocktails) is essential to prevent degradation. Finally, quality control should include regular checks via size-exclusion chromatography to monitor aggregation state and functional assays to confirm activity retention.

What analytical techniques provide the most reliable data on BAB2_1148 structure-function relationships?

A comprehensive understanding of BAB2_1148 structure-function relationships requires integration of multiple analytical techniques that address different aspects of protein structure and dynamics.

Spectroscopic techniques offer complementary structural information with less sample requirements. Circular dichroism spectroscopy provides data on secondary structure content and thermal stability. Fourier-transform infrared spectroscopy (FTIR) is particularly valuable for membrane proteins, offering insights into secondary structure and orientation within membranes. For more detailed conformational information, site-directed spin labeling combined with electron paramagnetic resonance (EPR) spectroscopy can map distance changes between specific residues during substrate binding or transport cycles.

Functional characterization requires techniques that directly measure transport activity or substrate binding. ATPase activity assays provide indirect evidence of transport function by measuring ATP hydrolysis rates in response to substrate addition. For direct transport measurements, reconstitution into proteoliposomes with fluorescent substrate analogs allows real-time monitoring of transport activity. Isothermal titration calorimetry (ITC) provides thermodynamic parameters of substrate binding, while surface plasmon resonance (SPR) or microscale thermophoresis (MST) offer kinetic binding data with minimal protein requirements.

What are the most promising future research directions for BAB2_1148 and related ABC transporters in Brucella species?

Future research on BAB2_1148 and related ABC transporters in Brucella species should pursue several promising directions that build upon current knowledge and exploit emerging technologies.

Comprehensive substrate identification represents a fundamental knowledge gap. While ABC transporters are presumed to transport specific substrates, the exact molecules transported by BAB2_1148 remain unidentified. Researchers should employ metabolomic approaches comparing wild-type and knockout strains to identify accumulated or depleted metabolites, suggesting potential substrates. Alternatively, transport assays using reconstituted protein in liposomes with libraries of potential substrates could directly identify transport specificity. Understanding the substrate profile would clarify the protein's role in Brucella physiology and potentially reveal why these transporters are essential during specific infection phases .

The regulatory networks controlling BAB2_1148 expression deserve exploration. Research has shown that ABC transporter deletion affects expression of other genes, suggesting interconnected regulatory systems . Chromatin immunoprecipitation sequencing (ChIP-seq) could identify transcription factors binding to the BAB2_1148 promoter region, while RNA-seq under various conditions (nutrient limitation, oxidative stress, low pH) would reveal expression patterns correlating with environmental challenges faced during infection. Understanding these regulatory networks could identify master regulators controlling multiple virulence systems, offering potential targets for broad-spectrum intervention.

The host-pathogen interface presents particularly exciting research opportunities. The observation that ABC transporter mutants show altered immune response patterns suggests direct or indirect interaction with host immunity . Advanced microscopy techniques like lattice light-sheet microscopy combined with specific labeling could track BAB2_1148 localization during different stages of intracellular infection. Proximity labeling approaches like BioID or APEX could identify host proteins interacting with the transporter during infection, potentially revealing how these proteins influence host response pathways. These studies might uncover novel immunomodulatory mechanisms exploitable for vaccine development.

How can systems biology approaches enhance our understanding of BAB2_1148's role in Brucella pathogenesis?

Systems biology approaches offer powerful frameworks for understanding BAB2_1148's role within the complex network of interactions that constitute Brucella pathogenesis.

Multi-omics integration represents a cornerstone of systems approaches to bacterial pathogenesis. Researchers should conduct parallel analyses of transcriptomics, proteomics, and metabolomics in wild-type and BAB2_1148 knockout strains under various conditions, particularly during infection. RNA-seq can identify genes differentially expressed in the mutant, while quantitative proteomics using techniques like TMT labeling can verify these changes at the protein level. Metabolomic profiling can identify altered metabolic pathways resulting from transporter dysfunction. Integration of these datasets using computational approaches like weighted gene co-expression network analysis (WGCNA) can identify functional modules affected by BAB2_1148 deletion, placing the transporter within broader cellular networks.

Network analysis approaches can reveal non-obvious connections between BAB2_1148 and other virulence systems. Protein-protein interaction studies using techniques like bacterial two-hybrid screening or co-immunoprecipitation followed by mass spectrometry can identify direct interaction partners. These data can be incorporated into broader interaction networks constructed from literature mining and public databases. Network analysis algorithms can then identify critical nodes and potential bottlenecks where intervention might disrupt multiple virulence systems simultaneously.

In silico modeling of BAB2_1148 function within cellular metabolism can provide insights into its system-level impacts. Genome-scale metabolic models of Brucella can be constructed or adapted from existing models, allowing flux balance analysis to predict how loss of specific transport functions affects metabolic capabilities. These models can generate testable hypotheses about which metabolic pathways become limiting during infection in the absence of BAB2_1148 function, potentially explaining the stage-specific attenuation observed in related transporter mutants . Such models can also predict potential compensatory pathways activated during later infection stages, guiding experimental validation.

What potential applications exist for BAB2_1148 in diagnostic or therapeutic development for brucellosis?

BAB2_1148 offers several promising applications for both diagnostic and therapeutic development in the context of brucellosis management.

For diagnostics, recombinant BAB2_1148 protein has significant potential as an antigen in serological assays. The commercial availability of purified recombinant protein facilitates development of enzyme-linked immunosorbent assays (ELISAs) that could detect anti-BAB2_1148 antibodies in patient sera. The advantage of using membrane proteins like BAB2_1148 in diagnostics is their high immunogenicity and potential specificity. If epitope mapping identifies regions unique to Brucella species, assays targeting these regions could offer improved specificity compared to current tests using lipopolysaccharide antigens, which can cross-react with other bacteria. Multiplexed approaches incorporating BAB2_1148 alongside other Brucella antigens could enhance diagnostic sensitivity and specificity simultaneously.

From a therapeutic perspective, ABC transporters like BAB2_1148 represent attractive drug targets due to their surface accessibility and essential functions. Structure-based drug design targeting the ATP-binding domain or substrate-binding pocket could yield specific inhibitors that prevent nutrient acquisition, thereby limiting bacterial survival within host cells. The stage-specific importance of ABC transporters in Brucella infection suggests such inhibitors might be particularly effective in early infection phases, potentially preventing establishment of chronic infection. High-throughput screening of chemical libraries against purified BAB2_1148 could identify lead compounds for further development.

For vaccine development, BAB2_1148 shows promise as a subunit vaccine component or for development of attenuated live vaccines. The observation that ABC transporter mutants show reduced virulence while maintaining immunogenicity suggests deletion or modification of BAB2_1148 could contribute to rational design of attenuated vaccine strains. These strains would ideally replicate sufficiently to induce robust immunity while being unable to establish persistent infection. Alternatively, epitope mapping of BAB2_1148 could identify protective B-cell and T-cell epitopes for inclusion in peptide-based or recombinant subunit vaccines, particularly if combined with appropriate adjuvants to enhance immunogenicity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.