Recombinant Brucella abortus Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Brucella abortus Protease HtpX Homolog (HtpX)

Brucella abortus is the causative agent of brucellosis, a widespread zoonotic disease . The bacterium encodes a variety of proteins that contribute to its survival and virulence within the host. Among these proteins is the HtpX homolog, a protease that belongs to the rhomboid family of intramembrane serine proteases .

Characteristics of HtpX

Rhomboid proteases are highly conserved across various life domains. In eukaryotes, their roles are well-defined, but their functions in bacterial physiology are still being elucidated . HtpX, found in Brucella abortus, exhibits proteolytic activity and can cleave model heterologous substrates such as Drosophila melanogaster Gurken and Providencia stuartii TatA .

Key characteristics of HtpX:

  • Protease Activity HtpX functions as an active protease, capable of cleaving specific substrates both in vitro and in vivo .

  • Inhibition The activity of HtpX can be inhibited by serine protease inhibitors like 3,4-dichloroisocoumarin (DCI) .

  • Structural Features HtpX contains a six-transmembrane domain core, typical of rhomboid proteases, along with an additional N-terminal transmembrane domain .

3.1. Proteomic Analysis

A study used shotgun proteomics to compare the proteomes of Brucella abortus mutant strains lacking the rhomboid gene with parental strains. Quantitative proteomics identified approximately 50% of the predicted B. abortus proteome under two experimental conditions, detecting 108 differentially represented proteins .

3.2. Role in Stress Response

The Brucella abortus HtrA protease, a homolog of HtpX, functions as a stress response protease in the periplasmic space, degrading damaged proteins resulting from environmental stresses . A B. abortus htrA mutant displayed a stress response-defective phenotype in vitro, showing increased sensitivity to hydrogen peroxide and the antibiotic puromycin .

3.3. Oxygen-Limiting Conditions

Deletion of rhomboid had no significant effect on virulence assays, but overexpression of rhomboid impaired growth under static conditions, which suggests it impacts denitrification enzymes and/or high oxygen affinity cytochrome c oxidase required for growth in low oxygen tension conditions .

3.4. Impact on Virulence

Deletion of rhomboid had no obvious effect on B. abortus virulence .

3.5. Subcellular Localization

Immunofluorescence and subcellular fractionation studies suggest that RhoX is an inner membrane protease .

Data Tables

Table 1: Sensitivity of B. abortus RWP11 to Stress Factors

Stress FactorParental Strain 2308Mutant Strain RWP11
Hydrogen Peroxide (H2O2)ResistantSensitive
PuromycinResistantSensitive
Elevated Temperature (41°C)Normal GrowthRestricted Growth

Table 2: Differentially Represented Proteins Related to Denitrification and Oxidative Phosphorylation

ProteinAccession Number
Nitrous-oxide reductase NosZQ2YJW2
Copper-containing nitrite reductaseQ2YJU8
Nitric oxide reductase subunit C (NorC)Q2YJT6
Nitrate reductase subunit beta (NarH)Q2YJY3
Nitrate reductase subunit alpha (NarG)Q2YJY4
Cbb3-type cytochrome c oxidase unit (high oxygen affinity)Q2YM85

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
htpX; BAbS19_I17020; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-325
Protein Length
full length protein
Species
Brucella abortus (strain S19)
Target Names
htpX
Target Protein Sequence
MNMTKTAMLIALMTVMFMSIGYLLGGGGGMMIALVIAVAMNLFGYWNSDKMVLRMYNAQE VDERSAPEYYRMVSGLAANAGLPMPKVYIIHEDQPNAFATGRNPENAAVAATTGLLNRLS PEEVAGVMAHELAHVQNRDTLTMTIVATLAGAISMLGNFAFFLGGNRENGNGVMGVVGTL LAMIVAPFGAMIVQMAVSRTREYAADKRGAEICGNPLWLSSALGRIARGAKVIPNEEAEH NPATAHMFIINPLSGRGADNLFSTHPDTDNRIAALEQMAAEMGIRSAAMTARAAAPSQNS GPWGQRSDNAGGNSNGGSRYRGPWS
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.