Recombinant Brucella abortus Putative peptide permease protein BAB2_0815 (BAB2_0815)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
BAB2_0815; Putative peptide permease protein BAB2_0815
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-302
Protein Length
full length protein
Species
Brucella abortus (strain 2308)
Target Names
BAB2_0815
Target Protein Sequence
MRSSIHASRLRKMGQSIPASTGPMARSANRFLQNRAAIFGLVLLTPLLFAVLTYPLWLPY KPNDIDLMAMNSAPSWKHWFGTDGVGRDVFARTMEGGRISLLVAVSSVVLSTAIGFLIGA ISALGGRWADAIAMRSVDLAMTLPPVIFLLVLASIIGSGIWSTVVVIALLSWPVLSRMIR ARLLELREREFVMASRGMGAGLGHLLFRHGLPNSIDILVVYATLQVANAILLEAGLSFLG LGVPPPAASWSNMLNAARSTAVLEQFPWQWLFPGGALVLAVLAINFIGDGLRDAFDPRAE LN
Uniprot No.

Target Background

Function
This protein is likely part of an ABC transporter complex involved in peptide import. It is probably responsible for translocating the substrate across the membrane.
Database Links
Protein Families
Binding-protein-dependent transport system permease family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the optimal conditions for handling recombinant BAB2_0815 protein?

The optimal handling conditions for recombinant BAB2_0815 depend on your experimental objectives. Based on available specifications for this protein:

ParameterRecommended ConditionNotes
Storage-20°C/-80°CFor extended storage
Working aliquots4°CFor up to one week
Reconstitution0.1-1.0 mg/mL in deionized sterile waterFor lyophilized preparations
Buffer compatibilityTris-based buffer with 50% glycerolOptimized for protein stability
Freeze-thaw cyclesMinimize repeated freezing and thawingPrepare single-use aliquots

When working with His-tagged BAB2_0815, recombinant preparations typically show high purity (>95%) when assessed by SDS-PAGE under reducing conditions . For experimental applications involving protein-protein interactions or functional assays, consider removing the His-tag using an appropriate protease if the tag might interfere with protein function .

How can BAB2_0815 be expressed and purified for research applications?

Expression methodology:

  • Selection of expression system: E. coli expression systems are commonly used for recombinant B. abortus proteins, as evidenced by successful expression of other B. abortus proteins such as ribH2 and Omp19 .

  • Vector design:

    • Include an N-terminal 6x histidine tag for purification

    • Select appropriate promoter (T7 or tac) for controlled expression

    • Optimize codon usage for E. coli if necessary

  • Purification strategy:

    • Lyse cells using sonication in appropriate buffer (100 mM NaH₂PO₄, 10 mM Tris-HCl, pH 8.0)

    • Purify using Ni-NTA affinity chromatography

    • Elute with imidazole gradient

    • Verify purity by SDS-PAGE

    • Dialyze to remove imidazole

    • For higher purity, consider additional purification steps (ion exchange, size exclusion)

The typical yield from E. coli expression systems for similar B. abortus recombinant proteins ranges from 5-15 mg/L of culture, with purity >95% after affinity chromatography .

What methodologies are recommended for investigating posttranslational modifications (PTMs) of BAB2_0815?

Research on B. abortus proteins has revealed extensive posttranslational modifications that significantly impact bacterial survival and virulence . A comprehensive approach to studying PTMs in BAB2_0815 would include:

Sample preparation:

  • Express and purify BAB2_0815 from both native B. abortus and recombinant systems

  • Prepare proteins from bacteria grown under different conditions (exponential phase, stationary phase, stress conditions)

Analytical techniques:

  • LC-MS/MS analysis with enrichment strategies:

    • Use antibody affinity enrichment for specific modifications

    • Apply high-resolution liquid chromatography-tandem mass spectrometry

    • Analyze data using appropriate software (e.g., MaxQuant, Proteome Discoverer)

  • Types of modifications to investigate:
    Based on patterns observed in other B. abortus proteins, key modifications to examine include:

    • Lysine 2-hydroxyisobutyrylation (Hib)

    • Lysine succinylation (Sc)

    • Lysine crotonylation (Cr)

    • Lysine acetylation (Ac)

    • Lysine malonylation (Ma)

  • Functional validation:

    • Generate site-directed mutants at modified residues

    • Compare protein function, localization, and interaction profiles between wild-type and mutant proteins

Recent research on B. abortus has shown that proteins involved in virulence and survival often exhibit multiple PTMs, which can significantly alter protein function during infection . For BAB2_0815, identifying specific modifications and their patterns under different growth conditions may provide insights into its regulation and function.

How does BAB2_0815 expression and function change under different environmental stress conditions?

To investigate how BAB2_0815 responds to environmental stresses, a systematic approach combining transcriptomic and proteomic analyses is recommended:

Experimental design:

  • Growth conditions to test:

    • Serum stress (mimicking host environment)

    • Nutrient limitation

    • pH stress (acidic and alkaline)

    • Oxidative stress

    • Temperature stress

  • Analysis methods:

    • qRT-PCR for gene expression analysis

    • Western blotting for protein level quantification

    • Proteomics using LC-MS/MS for relative quantitation

Data interpretation framework:
Based on research with other B. abortus proteins, significant expression changes often occur under serum stress, which is particularly relevant for understanding the protein's role during infection . Data analysis should include:

  • Comparative analysis across different stress conditions

  • Correlation of expression changes with functional pathways

  • Integration with known stress response networks in B. abortus

A study on B. abortus proteome under serum stress found 125 up-regulated and 88 down-regulated proteins compared to control conditions, with enrichment in pathways related to ABC transporters and biosynthesis of siderophores . This suggests that transport proteins like BAB2_0815 may play crucial roles in adaptation to host environments.

What role might BAB2_0815 play in Brucella abortus virulence and host-pathogen interactions?

Given that BAB2_0815 is a putative peptide permease, it may contribute to virulence through nutrient acquisition or signaling processes. To investigate its role:

Experimental approaches:

  • Gene knockout studies:

    • Generate a BAB2_0815 deletion mutant in B. abortus

    • Assess virulence in cellular and animal models

    • Compare bacterial survival and replication within host cells

  • Infection models:

    • Macrophage infection assays

    • Mouse infection model

    • C57BL/6 mouse model for chronic infection assessment

    • BALB/c mouse model for acute infection assessment

  • Protein localization during infection:

    • Generate fluorescently tagged BAB2_0815

    • Track protein localization during different stages of infection

    • Co-localization studies with host cell markers

Data analysis framework:
Research on B. abortus virulence factors has shown that many are regulated by quorum sensing systems, including the LuxR proteins VjbR and BabR . Analysis should consider:

  • Potential regulation of BAB2_0815 by quorum sensing

  • Temporal expression patterns during infection

  • Comparison with known virulence factors

Previous studies on B. abortus have demonstrated that survival in host cells is significantly affected by quorum sensing regulation and that many virulence factors show synergistic interactions . Similar approaches could reveal if BAB2_0815 functions in a network with other virulence factors.

What methodologies are most effective for studying protein-protein interactions involving BAB2_0815?

Recommended techniques:

  • Pull-down assays:

    • Express His-tagged BAB2_0815 in E. coli

    • Immobilize on Ni-NTA resin

    • Incubate with B. abortus lysate

    • Identify binding partners by mass spectrometry

  • Bacterial two-hybrid system:

    • Clone BAB2_0815 into bait vector

    • Screen against a prey library of B. abortus proteins

    • Validate interactions with co-immunoprecipitation

  • Crosslinking mass spectrometry:

    • Treat intact bacteria or purified BAB2_0815 with crosslinkers

    • Digest and analyze by LC-MS/MS

    • Identify crosslinked peptides to map interaction interfaces

  • Proximity labeling:

    • Generate a BAB2_0815-BioID fusion

    • Express in B. abortus

    • Identify proximal proteins through streptavidin purification and MS analysis

Data analysis considerations:
The analysis of protein interaction data should include:

  • Functional categorization of interaction partners

  • Integration with known protein complexes in B. abortus

  • Structural modeling of interaction interfaces

Research on other B. abortus proteins has revealed complex interaction networks, particularly for proteins involved in transport and virulence functions . Similar approaches would be valuable for understanding BAB2_0815's role within the bacterial protein interaction network.

How can functional assays be designed to characterize peptide transport activity of BAB2_0815?

As a putative peptide permease, BAB2_0815 likely functions in peptide transport across the bacterial membrane. To characterize this function:

In vitro transport assays:

  • Liposome reconstitution:

    • Purify recombinant BAB2_0815

    • Reconstitute into liposomes

    • Measure transport of fluorescently labeled peptides

    • Determine substrate specificity and kinetics

  • Whole-cell transport assays:

    • Generate BAB2_0815 overexpression and knockout strains

    • Measure uptake of radiolabeled or fluorescently labeled peptides

    • Compare transport rates between strains

Substrate specificity analysis:

  • Screen various peptides with different:

    • Lengths (di-, tri-, oligopeptides)

    • Amino acid compositions

    • Charges

    • Structural features

  • Analyze data to determine:

    • Km and Vmax for preferred substrates

    • Competitive inhibition profiles

    • Energy requirements (ATP-dependent or independent)

Functional validation in vivo:

  • Complementation studies:

    • Generate BAB2_0815 knockout

    • Assess growth on media with peptides as sole nitrogen source

    • Complement with wild-type and mutant versions of BAB2_0815

Similar methodologies have been used to characterize other bacterial transport proteins, revealing important insights into substrate specificity and transport mechanisms . These approaches would provide valuable functional characterization of BAB2_0815.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.