Recombinant Brucella abortus Putative peptide transport system permease protein BAB2_1050 (BAB2_1050)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant BAB2_1050 is a 314-amino-acid full-length protein (UniProt ID: Q2YJK1) expressed in Escherichia coli with an N-terminal His tag for purification . Key features include:

PropertySpecification
Gene NameBAB2_1050
SynonymsPutative peptide transport system permease protein BAB2_1050
Molecular Weight~35 kDa (calculated)
SourceBrucella abortus strain 2308
Expression HostE. coli
Purity≥85–90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0); -20°C/-80°C
ReconstitutionSterile deionized water (0.1–1.0 mg/mL) with optional glycerol for stability

Expression and Purification

  • Expression System: E. coli DH5α or BL21 strains .

  • Purification: Affinity chromatography using His-tag .

  • Validation: Western blot confirmed reactivity with Brucella-positive serum .

Stability and Handling

  • Lyophilization: Enhances long-term storage at -80°C .

  • Avoidance of Freeze-Thaw Cycles: Critical to prevent protein degradation .

Comparative Vaccine Development

  • Recombinant Brucella proteins like L7/L12 ribosomal protein and outer membrane proteins (OMPs) have been tested as subunit vaccines, demonstrating efficacy in murine models .

  • BAB2_1050’s transmembrane localization suggests it could expose immunogenic epitopes, though this remains unexplored .

Antigenic Potential

  • Immunoblotting confirms BAB2_1050 reacts with Brucella-positive sera, supporting its utility in serodiagnostic assays .

Limitations and Future Directions

  • Functional Studies: No direct evidence yet links BAB2_1050 to peptide transport activity or virulence in Brucella.

  • Vaccine Trials: Unlike RB51-derived vaccines expressing listeriolysin O (LLO) or apoptotic proteins , BAB2_1050 has not been tested in vivo.

  • Phylogenetic Context: Genomic analyses place B. abortus in four major clades, with clade D dominating in cattle globally . BAB2_1050’s conservation across clades is uncharacterized.

Key Research Gaps

AspectCurrent KnowledgeUnanswered Questions
Mechanistic RolePutative ABC transporter permease Substrate specificity and transport kinetics unknown.
Immune ResponseReacts with antisera Protective efficacy as a vaccine antigen untested.
Evolutionary ConservationGene present in B. abortus strain 2308 Distribution across Brucella species/clades unclear.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery times, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. The shelf life of lyophilized forms is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize development of the specified tag.
Synonyms
BAB2_1050; Putative peptide transport system permease protein BAB2_1050
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-314
Protein Length
full length protein
Species
Brucella abortus (strain 2308)
Target Names
BAB2_1050
Target Protein Sequence
MTALILKRVAQAIPVMLIVAILTFLLMKLLPGDPAILIAGDGASPETVERIRVELGLDQP TVVQLGQWLWNLFHFDLGRSFLLSQPVSQAIAERLPVTISLALLAFAITIPVGIIMGVVA AYLRDSWFDTGVMSLALLGVSVPSFWLAILAVILFSVTLGWFPSAGYVPFLDSPLGWLRS LILPASILALFQIGYLARMTRSEMLEVMDQDYIRTARSKGVSEYSVLSTHAFRNALVSVL TVSGYIFSLLIGGSVVIEQIFALPGLGRLLVQAILARDLPVVQGTMLFLGFLFVAINVLV DILYTIADPRVRYD
Uniprot No.

Target Background

Function
This protein is likely part of an ABC transporter complex involved in peptide import. It is likely responsible for transporting the substrate across the membrane.
Database Links
Protein Families
Binding-protein-dependent transport system permease family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is BAB2_1050 and what is its role in Brucella abortus?

BAB2_1050 is a putative peptide transport system permease protein in Brucella abortus, functioning as part of an ABC transporter system. The protein consists of 314 amino acids and contains multiple transmembrane domains, characteristic of permease proteins involved in substrate translocation across bacterial membranes . Based on homology with similar transport systems in other bacteria, BAB2_1050 likely plays a critical role in nutrient acquisition and potentially contributes to antimicrobial peptide (AMP) resistance, similar to the YejABEF transporter system identified in Brucella melitensis . This protein may be essential for bacterial survival within host cells by facilitating the transport of peptides and potentially contributing to acid resistance mechanisms necessary for survival in the acidic environment of macrophages .

How does BAB2_1050 relate to other ABC transporters in Brucella species?

BAB2_1050 shares functional similarities with other ABC transporters in Brucella species, particularly the YejABEF transporter system identified in B. melitensis . Research indicates that ABC transporters play critical roles in Brucella virulence and survival within host cells. For instance, the YejABEF system in B. melitensis is required for resistance to host antimicrobial peptides and for bacterial replication inside macrophages .

While BAB2_1050 has not been as extensively characterized as YejABEF, comparative genomic analyses suggest functional homology. Both transport systems likely contribute to the bacteria's ability to withstand host defense mechanisms, particularly antimicrobial peptides that target bacterial membranes. Gene deletion studies of YejABEF components have demonstrated increased sensitivity to acidic stress and antimicrobials like polymyxin B, with significant reductions in virulence and persistence in host cells .

What are the optimal conditions for expressing recombinant BAB2_1050 protein?

For optimal expression of recombinant BAB2_1050 protein, the following protocol has been established:

  • Expression System: E. coli has proven effective for expressing BAB2_1050, with the protein fused to an N-terminal His tag to facilitate purification .

  • Expression Vector: Vectors containing strong inducible promoters (e.g., T7 promoter in pET series vectors) are recommended for controlled expression.

  • Induction Conditions: Optimal induction typically occurs at OD600 of 0.6-0.8, with IPTG concentrations of 0.1-1.0 mM. Due to the membrane protein nature of BAB2_1050, lower induction temperatures (16-25°C) and longer induction times (overnight) may improve proper folding and reduce inclusion body formation.

  • Cell Lysis and Extraction: Since BAB2_1050 is a membrane protein, specialized detergent-based extraction methods are necessary. A combination of mechanical disruption (sonication or French press) followed by solubilization with mild detergents (e.g., n-dodecyl β-D-maltoside or Triton X-100) at concentrations above their critical micelle concentration is recommended.

  • Purification Strategy: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin is effective for initial purification, followed by size exclusion chromatography to achieve higher purity.

How should recombinant BAB2_1050 protein be stored to maintain stability and activity?

For optimal stability and activity of recombinant BAB2_1050 protein, the following storage conditions are recommended:

  • Short-term Storage: Store working aliquots at 4°C for up to one week to minimize freeze-thaw cycles .

  • Long-term Storage: Store at -20°C/-80°C in small aliquots to prevent repeated freeze-thaw cycles .

  • Storage Buffer: A Tris/PBS-based buffer (pH 8.0) containing 6% trehalose is recommended for maintained stability .

  • Reconstitution: Lyophilized protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Cryoprotectant: Addition of glycerol to a final concentration of 5-50% (optimally 50%) before aliquoting is recommended for long-term storage at -20°C/-80°C .

  • Quality Control: Periodic assessment of protein activity and integrity using SDS-PAGE and functional assays is advised to monitor stability over time.

What experimental designs are most appropriate for studying BAB2_1050 function in vitro?

When designing experiments to study BAB2_1050 function in vitro, several approaches can be employed:

  • Transport Assays: Reconstitute purified BAB2_1050 into proteoliposomes and measure the uptake of fluorescently labeled peptides or radiolabeled substrates to assess transport activity.

  • ATPase Activity Assays: Since BAB2_1050 is part of an ABC transporter system, coupling it with its cognate ATPase component allows for measurement of ATP hydrolysis rates in response to potential substrates.

  • Binding Assays: Employ techniques such as isothermal titration calorimetry (ITC), surface plasmon resonance (SPR), or microscale thermophoresis (MST) to characterize the binding affinity of BAB2_1050 for various peptide substrates.

  • Structural Studies: Use techniques such as X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy to determine the three-dimensional structure of BAB2_1050, which can provide insights into its mechanism of action.

  • Factorial Design Approach: Implement a full factorial design when testing multiple variables such as pH, temperature, and substrate concentration to identify optimal conditions and potential interactions . For example:

FactorLow LevelHigh Level
pH5.57.5
Temperature (°C)2537
Substrate concentration (μM)10100

A full factorial design would test all combinations of these factors to determine their effects on BAB2_1050 transport activity.

How does BAB2_1050 contribute to Brucella abortus virulence and pathogenesis?

Based on studies of homologous systems, BAB2_1050 likely plays several critical roles in Brucella abortus virulence and pathogenesis:

  • Antimicrobial Peptide Resistance: Similar to the YejABEF transporter in B. melitensis, BAB2_1050 may contribute to resistance against host antimicrobial peptides, which are an important component of innate immunity . This resistance mechanism would enable the bacteria to survive initial host defense responses.

  • Intracellular Survival: ABC transporters in Brucella have been shown to be essential for intracellular survival and replication within macrophages . By facilitating nutrient acquisition and/or contributing to membrane integrity, BAB2_1050 likely supports bacterial persistence in this hostile environment.

  • Acid Resistance: Studies with deletion mutants of homologous transporters have demonstrated increased sensitivity to acidic stress . Since Brucella encounters acidic environments within the macrophage phagosome, acid resistance is crucial for pathogenesis.

  • Contribution to Chronic Infection: The ability of Brucella to establish persistent infections depends on multiple virulence factors, including transport systems that enable adaptation to changing host environments. BAB2_1050 may support the long-term survival strategies that make brucellosis difficult to treat.

What phenotypic changes are observed in BAB2_1050 deletion mutants?

Based on studies of homologous ABC transporter components in Brucella species, deletion of BAB2_1050 would likely result in the following phenotypic changes:

  • Increased Sensitivity to Antimicrobial Peptides: Mutants would show significantly increased sensitivity to host-derived antimicrobial peptides and to polymyxin B, which is often used as a model for cationic antimicrobial peptides .

  • Reduced Acid Tolerance: Deletion mutants would exhibit decreased survival under acidic conditions, similar to what has been observed with YejE deletion mutants in B. melitensis .

  • Attenuated Intracellular Replication: The mutants would demonstrate restricted invasion and replication capabilities inside macrophages, a critical cell type for Brucella pathogenesis .

  • Reduced Virulence in Animal Models: Similar to YejABEF deletion mutants, BAB2_1050 mutants would likely be rapidly cleared from the spleens of infected mice, indicating an essential role in establishing persistent infection .

  • Altered Membrane Properties: Changes in membrane permeability or integrity might be observed due to the loss of this integral membrane protein component.

How does BAB2_1050 interact with host immune responses during Brucella infection?

The interaction between BAB2_1050 and host immune responses during Brucella infection likely involves several mechanisms:

  • Evasion of Antimicrobial Peptides: By contributing to resistance against antimicrobial peptides, BAB2_1050 helps Brucella evade this early component of host innate immunity . This evasion is critical during the initial stages of infection.

  • Adaptation to Phagolysosomal Environment: Within macrophages, Brucella resides in a modified phagosome that eventually fuses with elements of the endoplasmic reticulum. BAB2_1050 may facilitate adaptation to this intracellular niche by mediating the transport of essential nutrients or by contributing to membrane modifications that protect against host microbicidal mechanisms.

  • Modulation of Inflammatory Responses: By enabling bacterial persistence, BAB2_1050 indirectly influences the chronic inflammatory response characteristic of brucellosis. Long-term bacterial survival leads to prolonged immune stimulation, contributing to the pathology of the disease.

  • Contribution to Stealth Strategy: Brucella employs a "stealth" strategy to avoid robust activation of innate immunity. Transport systems like BAB2_1050 may contribute to this strategy by helping maintain cellular homeostasis under stress conditions, preventing bacterial death that would release pathogen-associated molecular patterns (PAMPs) that strongly activate immune responses.

What comparative genomic approaches can reveal the evolutionary significance of BAB2_1050?

To investigate the evolutionary significance of BAB2_1050, researchers can employ several comparative genomic approaches:

Such analyses would provide insights into how this transporter has evolved in the context of Brucella's adaptation to its host-pathogen lifestyle and identify conserved features that might represent potential therapeutic targets.

How can structural biology approaches enhance our understanding of BAB2_1050 function?

Structural biology approaches can significantly enhance our understanding of BAB2_1050 function through:

  • X-ray Crystallography: Determining the crystal structure of BAB2_1050 would reveal detailed atomic-level information about its fold, binding pockets, and potential interaction interfaces. The challenge with membrane proteins like BAB2_1050 is obtaining well-diffracting crystals, which may require specialized techniques such as lipidic cubic phase crystallization.

  • Cryo-Electron Microscopy (Cryo-EM): This technique is increasingly useful for membrane protein structural determination and could reveal the structure of BAB2_1050 within the context of the complete ABC transporter complex, providing insights into the conformational changes associated with transport.

  • Nuclear Magnetic Resonance (NMR) Spectroscopy: While challenging for full-length membrane proteins, NMR can provide valuable information about protein dynamics and ligand binding, particularly for specific domains or fragments of BAB2_1050.

  • Computational Modeling and Molecular Dynamics: Homology modeling based on structures of related transporters, followed by molecular dynamics simulations, can generate testable hypotheses about substrate specificity, transport mechanisms, and the effects of mutations.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): This technique can identify regions of BAB2_1050 that undergo conformational changes upon substrate binding or interaction with other components of the transport system.

These structural approaches would help identify the substrate-binding site, explain the mechanism of substrate translocation, and potentially reveal how BAB2_1050 contributes to antimicrobial peptide resistance.

What proteomics approaches are most suitable for studying BAB2_1050 interactions?

To study BAB2_1050 protein interactions, several proteomics approaches can be employed:

  • Affinity Purification Coupled with Mass Spectrometry (AP-MS): Using His-tagged BAB2_1050 as bait, researchers can purify protein complexes and identify interacting partners through mass spectrometry. For membrane proteins like BAB2_1050, careful optimization of detergents is crucial to maintain native interactions.

  • Cross-linking Mass Spectrometry (XL-MS): Chemical cross-linking followed by MS analysis can capture transient interactions and provide spatial constraints for protein complex modeling. This is particularly valuable for studying dynamic ABC transporter complexes.

  • Proximity-dependent Biotin Identification (BioID): Fusing BAB2_1050 with a biotin ligase (BirA*) allows biotinylation of proximal proteins in the native cellular environment, which can then be purified and identified by MS.

  • Thermal Proteome Profiling (TPP): This approach can identify potential substrates or interacting partners based on changes in thermal stability upon binding to BAB2_1050.

  • Membrane Yeast Two-Hybrid System: Specialized yeast two-hybrid systems designed for membrane proteins can systematically screen for interacting partners.

  • Quantitative Interactomics: Label-free quantification or isobaric labeling techniques (TMT, iTRAQ) can compare the interactome of wild-type BAB2_1050 versus mutant variants to identify functionally relevant interactions.

Implementation of these approaches requires consideration of the membrane environment and should include appropriate controls for non-specific binding, which is a common challenge when working with membrane proteins.

How might BAB2_1050 serve as a target for novel antibrucellosis therapeutics?

BAB2_1050 presents several characteristics that make it a promising target for novel antibrucellosis therapeutics:

  • Essential Role in Virulence: Based on studies of homologous ABC transporters, BAB2_1050 likely plays a critical role in Brucella virulence and persistence . Inhibiting this protein could potentially attenuate infection.

  • Membrane Accessibility: As a membrane protein, parts of BAB2_1050 are likely exposed to the periplasm or extracellular environment, making it potentially accessible to drug molecules without needing to cross the bacterial cytoplasmic membrane.

  • Unique Structural Features: Detailed structural analysis of BAB2_1050 might reveal binding pockets or functional domains that differ sufficiently from host proteins, allowing for selective targeting.

  • Combination Therapy Potential: Inhibitors targeting BAB2_1050 could potentially sensitize Brucella to existing antimicrobial peptides or conventional antibiotics, providing synergistic treatment options.

  • Resistance Prevention: Targeting virulence factors like BAB2_1050 rather than essential growth functions might reduce selection pressure for resistance development.

Potential therapeutic approaches include:

  • Small molecule inhibitors that block the substrate-binding site or interfere with conformational changes required for transport

  • Peptide mimetics that compete with natural substrates but cannot be transported

  • Antibody-based therapeutics targeting exposed epitopes

  • Peptidomimetic molecules that specifically bind to and inactivate the transporter

What experimental models are most appropriate for evaluating BAB2_1050 as a vaccine candidate?

To evaluate BAB2_1050 as a vaccine candidate, researchers should consider the following experimental models and approach:

  • In Vitro Models:

    • Macrophage Infection Assays: Assess whether vaccination induces antibodies or T-cells that can reduce bacterial replication in macrophages .

    • Neutralization Assays: Test if antibodies against BAB2_1050 can inhibit its function or reduce bacterial viability.

    • T-cell Activation Assays: Measure the ability of BAB2_1050 to stimulate specific T-cell responses in cells from vaccinated animals.

  • Animal Models:

    • Mouse Model: Although mice don't develop the same clinical disease as ruminants, they are useful for initial immunogenicity and protection studies. Measurement of bacterial load in spleen following challenge with virulent B. abortus is a standard endpoint .

    • Natural Host Models: For advanced testing, experiments in cattle, bison, or other natural hosts of B. abortus should be conducted to evaluate protection against abortion and infection .

    • Challenge Studies Design: Implementation of factorial design approaches to evaluate variables such as vaccine formulation, adjuvant type, and vaccination schedule .

  • Vaccination Strategies:

    • Subunit Vaccines: Testing recombinant BAB2_1050 with various adjuvants

    • DNA Vaccines: Evaluating plasmids encoding BAB2_1050

    • Live Attenuated Approach: Using BAB2_1050 deletion mutants as potential attenuated vaccine strains

    • Prime-Boost Strategies: Combining different delivery platforms for enhanced immunity

  • Immune Response Evaluation:

    • Measure both humoral (antibody) and cell-mediated (T-cell) responses

    • Evaluate long-term immunity through extended challenge studies

    • Assess cross-protection against different Brucella species

Evaluation ParameterMouse ModelNatural Host Model
Bacterial clearance in spleenPrimary endpointSecondary endpoint
Protection against abortionNot applicablePrimary endpoint
Antibody responseEasily measuredEasily measured
T-cell responseDetailed analysis possibleMore limited assays
Duration of immunity3-6 months typically assessedShould assess >1 year

How can systems biology approaches integrate BAB2_1050 function into broader Brucella pathogenesis networks?

Systems biology approaches can provide a comprehensive understanding of how BAB2_1050 functions within the broader context of Brucella pathogenesis networks:

  • Multi-omics Integration: Combining transcriptomics, proteomics, and metabolomics data from wild-type and BAB2_1050 mutant strains under various conditions (e.g., acid stress, antimicrobial peptide exposure, intracellular growth) can reveal how BAB2_1050 influences global bacterial responses.

  • Network Analysis: Constructing protein-protein interaction networks, metabolic networks, and gene regulatory networks that include BAB2_1050 can identify key pathways and processes affected by this transporter.

  • Flux Balance Analysis: Mathematical modeling of metabolic fluxes in the presence and absence of BAB2_1050 can predict how this transporter influences bacterial metabolism during infection.

  • Host-Pathogen Interaction Modeling: Integrating bacterial and host response data to model the dynamic interplay between Brucella and host cells, highlighting how BAB2_1050 contributes to this interaction.

  • Comparative Systems Analysis: Comparing system-wide responses across different Brucella species and strains with varying virulence properties can contextualize the role of BAB2_1050 in the evolution of pathogenesis.

  • Perturbation Analysis: Systematically testing how perturbations to BAB2_1050 (through mutations, inhibitors, or environmental stresses) propagate through the bacterial cellular network to affect virulence phenotypes.

These approaches would help identify:

  • Key signaling pathways that regulate BAB2_1050 expression or activity

  • Metabolic dependencies on BAB2_1050 function

  • Compensatory mechanisms that might activate when BAB2_1050 is inhibited

  • Potential synergistic targets for combination therapeutic approaches

What are the most promising future research directions for BAB2_1050?

The most promising future research directions for BAB2_1050 include:

  • Substrate Specificity Determination: Identifying the natural substrates transported by BAB2_1050 would provide critical insights into its physiological role. High-throughput screening approaches combined with metabolomics could help identify potential peptide or non-peptide substrates.

  • Structure-Function Analysis: Resolving the three-dimensional structure of BAB2_1050 alone and in complex with other components of the transport system would enhance our understanding of its mechanism and facilitate rational drug design.

  • Host-Pathogen Interface Studies: Investigating how BAB2_1050 interacts with host defense mechanisms, particularly antimicrobial peptides, could reveal novel aspects of Brucella's immune evasion strategies.

  • In Vivo Expression and Regulation: Determining when and where BAB2_1050 is expressed during different stages of infection would help elucidate its role in pathogenesis. Techniques such as in vivo expression technology (IVET) or dual RNA-seq could be valuable for this purpose.

  • Translational Research: Developing and testing inhibitors or vaccines targeting BAB2_1050 could lead to novel therapeutic or preventive strategies against brucellosis.

  • Comparative Analysis Across Pathogens: Investigating similar transport systems in other intracellular pathogens could reveal conserved mechanisms of adaptation to the intracellular niche.

  • Synthetic Biology Applications: Engineering BAB2_1050 variants with altered substrate specificities or regulatory properties could provide tools for understanding transporter evolution and function.

What interdisciplinary approaches might yield novel insights into BAB2_1050 biology?

Interdisciplinary approaches that could yield novel insights into BAB2_1050 biology include:

  • Biophysics-Biochemistry Integration: Combining single-molecule techniques (such as FRET or optical tweezers) with biochemical assays to understand the conformational dynamics and energetics of BAB2_1050 transport cycles.

  • Computational Biology-Structural Biology Synergy: Using machine learning and molecular dynamics simulations to predict substrate binding sites and conformational changes, validated by experimental structural studies.

  • Immunology-Microbiology Collaboration: Investigating how BAB2_1050 interacts with specific host immune components, particularly in the context of chronic infection establishment.

  • Systems Biology-Synthetic Biology Approaches: Creating synthetic circuits to control BAB2_1050 expression and studying the resulting system-wide effects to understand its regulatory network.

  • Chemical Biology-Proteomics Integration: Developing chemical probes specific for BAB2_1050 to identify interacting partners and track its localization during infection.

  • Evolutionary Biology-Functional Genomics Combination: Studying BAB2_1050 homologs across diverse bacterial species to understand how this transport system has evolved and adapted to different ecological niches.

  • Nanotechnology Applications: Developing nanoscale delivery systems for BAB2_1050 inhibitors that can specifically target Brucella within host cells.

  • Clinical Microbiology-Basic Research Integration: Correlating variations in BAB2_1050 sequences from clinical isolates with disease outcomes to identify functionally significant polymorphisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.