Recombinant Brucella abortus Putative peptide transport system permease protein BAB2_1051 (BAB2_1051)

Shipped with Ice Packs
In Stock

Description

Expression and Purification

  • Cloning: The BAB2_1051 gene was cloned into a plasmid vector and expressed in E. coli. The His tag facilitates purification via affinity chromatography .

  • Yield: Typical yields exceed 90% purity post-purification, ideal for immunological and structural studies .

Research Applications

  • Antigen Production: Used in ELISA kits for antibody detection in brucellosis research .

  • Vaccine Development: While not directly tested in vaccines, recombinant Brucella proteins (e.g., Omp25, VirB) are common targets for subunit vaccines. BAB2_1051’s membrane localization makes it a potential candidate .

  • Host-Pathogen Interaction Studies: Permeases are critical for bacterial nutrient acquisition, making BAB2_1051 relevant for studying Brucella metabolism in hostile host environments .

Comparative Analysis with Related Proteins

ProteinFunctionRegulationRole in Virulence
BAB2_1051Peptide transportUnknownPutative membrane homeostasis
Omp25Outer membrane proteinBvrR/BvrS-dependentImmune evasion
VirBType IV secretion systemBvrR/BvrS-dependentIntracellular survival
BvrR/BvrSTwo-component regulatory systemAutoregulatedMaster virulence control

Technical Considerations

  • Stability: Storage at -20°C/-80°C is recommended. Lyophilization in trehalose preserves conformational integrity .

  • Cytotoxicity: No direct cytotoxicity data exist for BAB2_1051, but recombinant Brucella proteins like LLO (listeriolysin O) have demonstrated enhanced macrophage apoptosis in vaccine studies .

Challenges and Future Directions

  • Functional Validation: The exact role of BAB2_1051 in peptide transport or virulence remains uncharacterized. Knockout studies or structural analyses (e.g., cryo-EM) could clarify its mechanism.

  • Vaccine Potential: Fusion with adjuvants or delivery via live-attenuated vectors (e.g., RB51 strain) may enhance immunogenicity .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
BAB2_1051; Putative peptide transport system permease protein BAB2_1051
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-296
Protein Length
full length protein
Species
Brucella abortus (strain 2308)
Target Names
BAB2_1051
Target Protein Sequence
MTELASPTSFSMPDIGKSPVVLTARRLMRHRSFRIGLVLLLIVVLAAVLAPWITNGKPNA TSVRMRFQPPGLEHLFGTDNFGRDLWTRVLYGAQVSLWIGLTVAVLSAILGAIIGIAAAW YRRFDTLLMRVMDALMAFPAILLAIGISAALGPHLSSVIIALTSAYIPRCARIVRASALV LRETDYVDAARLAGASDLRIITRHILPNCLAPLLVTLTFVFAYAILAEATLSFLGIGTPP PHASWGSIVAQGRDYSVDAWWIMLFPGIAITISALAINLIGDGLRDVLDPRLKMEG
Uniprot No.

Target Background

Function
This protein is likely part of an ABC transporter complex involved in peptide import. It is probably responsible for translocating the substrate across the membrane.
Database Links
Protein Families
Binding-protein-dependent transport system permease family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Brucella abortus and why is the BAB2_1051 protein significant in research?

Brucella abortus is a Gram-negative, non-encapsulated, non-motile, facultatively intracellular coccobacillus that causes brucellosis, a zoonotic disease of domestic and wild ungulates. The bacteria can be transmitted to humans through ingestion of contaminated food, direct contact with infected animals, or inhalation of aerosols, making it an important public health concern . The BAB2_1051 protein functions as a putative peptide transport system permease protein that likely plays a role in nutrient acquisition and potentially in pathogenesis through involvement in the bacterial transport systems.

Research on the BAB2_1051 protein is significant because bacterial transport systems, particularly ABC transporters, are increasingly recognized as important virulence factors. In the transcriptome analysis of Brucella abortus, twelve genes encoding ABC transport systems were found to be differentially expressed between wild-type and avirulent mutant strains, highlighting their importance in bacterial physiology and pathogenicity . Understanding the structure, function, and regulation of BAB2_1051 may contribute to identifying new targets for antimicrobial therapies and vaccine development.

What methodologies are commonly used to express and purify recombinant Brucella proteins?

Several expression systems can be employed for the production of recombinant Brucella proteins, each with specific advantages depending on research objectives:

Expression SystemAdvantagesLimitationsApplication for BAB2_1051
E. coliHigh yield, cost-effective, rapid growthMay lack appropriate post-translational modifications, inclusion body formation common with membrane proteinsSuitable for initial characterization studies with proper solubilization strategies
YeastEukaryotic post-translational modifications, high expression levelsLonger production time than E. coli, hyperglycosylation possibleGood for functional studies requiring proper protein folding
BaculovirusComplex eukaryotic processing, high expression levelsMore expensive, technically demandingExcellent for structural studies requiring native-like protein
Mammalian CellMost authentic post-translational modificationsHighest cost, lowest yield, time-consumingBest for functional assays requiring mammalian-specific modifications

For purification of membrane proteins like BAB2_1051, a methodological approach typically involves:

  • Cell lysis with detergents (e.g., n-dodecyl β-D-maltoside or Triton X-100)

  • Affinity chromatography using His-tagged constructs

  • Size exclusion chromatography to ensure purity

  • Validation of structure and function using circular dichroism and activity assays

The choice of expression system should be guided by the specific research questions and downstream applications of the recombinant protein.

How does the experimental design influence the study of Brucella virulence factors?

When studying Brucella virulence factors like BAB2_1051, researchers must carefully consider whether an observational or manipulative experimental design is most appropriate. In an observational design, natural variation in the population is observed without applying treatments, while in a manipulative (experimental) design, the investigator controls external factors and manipulates treatment factors .

For BAB2_1051 research, manipulative designs typically involve:

  • Gene knockout or knockdown studies to observe phenotypic changes

  • Complementation experiments to confirm the role of the protein

  • Controlled infection models with wild-type and mutant strains

  • Transcriptomic or proteomic analysis to understand regulatory networks

The BvrR/BvrS two-component system studies provide an excellent model for experimental design in Brucella research. Researchers used transcriptome analysis comparing wild-type and bvrR mutant strains to identify 127 differentially expressed genes, revealing the system's impact on cell envelope modulation, carbon and nitrogen metabolism, and potential cross-regulation with other systems . Similar approaches could be applied to understand BAB2_1051 function in the context of Brucella pathogenicity.

What role does BAB2_1051 potentially play in the Brucella membrane transport system?

As a putative peptide transport system permease protein, BAB2_1051 likely forms part of an ABC transport system complex that facilitates the movement of peptides across the bacterial membrane. In bacterial physiology, these systems are crucial for nutrient acquisition, osmoregulation, and potentially virulence.

Transcriptome analysis of Brucella has revealed that ABC transport systems are significantly regulated in response to environmental conditions and virulence requirements. Among the 127 differentially expressed genes identified in a comparison between wild-type and bvrR mutant strains, twelve genes encoding ABC transport systems were affected, highlighting their importance in Brucella physiology and adaptation .

The functional characterization of BAB2_1051 would likely involve:

  • Identification of substrate specificity

  • Elucidation of protein-protein interactions with other transport complex components

  • Assessment of expression patterns under different environmental conditions

  • Determination of the role in nutrient acquisition and potential virulence

Understanding these aspects could provide insights into how Brucella adapts to different environments, including the transition from extracellular to intracellular niches during infection.

How does the regulation of BAB2_1051 relate to the BvrR/BvrS two-component regulatory system?

The BvrR/BvrS two-component system is essential for Brucella abortus virulence, with its dysfunction altering the expression of major outer membrane proteins and lipid A acylation patterns . While the direct regulation of BAB2_1051 by BvrR/BvrS is not explicitly detailed in the search results, the system's impact on membrane transport proteins suggests potential regulatory connections.

In the transcriptome analysis of BvrR/BvrS function, several transcriptional regulators were affected, including VjbR, ExoR, and OmpR, which were less expressed in the bvrR mutant . These regulators may form part of a complex network controlling the expression of membrane proteins, potentially including BAB2_1051.

A methodological approach to investigate this relationship would include:

  • Quantitative RT-PCR analysis of BAB2_1051 expression in wild-type vs. bvrR/bvrS mutants

  • Chromatin immunoprecipitation (ChIP) assays to detect direct binding of BvrR to the BAB2_1051 promoter

  • Reporter gene assays to assess promoter activity under different conditions

  • Protein-protein interaction studies to identify potential regulatory complexes

Understanding these regulatory mechanisms could provide insights into how Brucella coordinates the expression of virulence factors during infection.

What methodological approaches can be used to study the immunogenicity of BAB2_1051?

The immunogenic potential of Brucella proteins has significant implications for vaccine development and diagnostics. Research with other Brucella proteins, such as the recombinant 31-kDa outer membrane protein (rOmp31), demonstrates how immunogenicity studies can be conducted .

For BAB2_1051 immunogenicity studies, researchers could employ the following methodological framework:

MethodologyPurposeExpected OutcomesAnalysis Approach
Mouse immunization with recombinant proteinAssess protective efficacyProtection against challenge, antibody responseBacterial load quantification, survival analysis
Antibody isotype profilingCharacterize humoral responseIgG1/IgG2 ratiosELISA, flow cytometry
Cytokine profilingAssess T-cell response typeTh1/Th2 balance determinationELISA, RT-PCR for IL-2, IFN-γ, IL-4, IL-10
T-cell subset depletionDetermine protective cell populationsRole of CD4+ vs CD8+ T cellsIn vitro and in vivo depletion studies
Epitope mappingIdentify immunodominant regionsPotential peptide vaccine candidatesSynthetic peptide analysis, T-cell proliferation assays

The rOmp31 studies found that immunization conferred protection against B. ovis and B. melitensis, induced a vigorous IgG response with higher IgG1 than IgG2 titers, and stimulated a Th1 response mediated by CD4+ T cells . Similar methodological approaches could determine if BAB2_1051 possesses comparable immunogenic properties.

How can contradictory data about BAB2_1051 function be reconciled in the context of different experimental models?

Researchers studying bacterial membrane proteins often encounter contradictory results across different experimental systems. When facing conflicting data regarding BAB2_1051 function, a systematic approach to reconciliation includes:

  • Standardization of experimental conditions:

    • Ensure consistent expression systems and purification methods

    • Standardize buffer compositions and assay conditions

    • Control for protein concentration and purity

  • Cross-validation using multiple methodologies:

    • Combine in vitro biochemical assays with in vivo functional studies

    • Use both genetic approaches (knockout/knockdown) and protein-level studies

    • Apply both structural analyses and functional assays

  • Comprehensive contextual analysis:

    • Consider strain-specific variations in protein sequence and expression

    • Evaluate the impact of host cell type on protein function

    • Assess the influence of environmental conditions on protein activity

  • Meta-analysis approach:

    • Systematically review all available data with standardized criteria

    • Weight evidence based on methodological rigor

    • Develop integrated models that accommodate apparently contradictory findings

A table comparing results across different experimental systems could help visualize contradictions and potential explanations:

Experimental SystemObserved FunctionContradictory FindingPotential Reconciliation
In vitro biochemistryTransport activity for specific peptidesNo transport activity detected in certain conditionspH or cofactor dependence of activity
Cell culture infection modelRequired for intracellular survivalDispensable in certain cell typesCell-type specific microenvironments
Mouse infection modelEssential for virulenceMinimal attenuation in certain organsOrgan-specific nutritional requirements
Structural studiesPredicted substrate binding sitesDifferent binding characteristics observedAllosteric regulation or conformational changes

This systematic approach acknowledges that biological systems are complex and that seemingly contradictory data may reflect different aspects of multifunctional proteins operating in diverse contexts.

What integration strategies can link BAB2_1051 function to broader Brucella metabolic networks?

Understanding how BAB2_1051 integrates into Brucella's metabolic networks requires sophisticated systems biology approaches. The transcriptome analysis of the BvrR/BvrS system revealed that genes involved in carbon metabolism (including pckA and fumB) and denitrification (nirK, norC, and nosZ) were differentially regulated in mutant strains , suggesting complex metabolic adaptations during infection.

For BAB2_1051, researchers could employ:

  • Multi-omics integration approaches:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Develop computational models of substrate flow through transport systems

    • Use flux balance analysis to predict metabolic consequences of BAB2_1051 dysfunction

  • Network analysis methodologies:

    • Construct protein-protein interaction networks

    • Map genetic interactions through synthetic lethality screens

    • Apply pathway enrichment analysis to contextualize BAB2_1051 function

  • Temporal and spatial dynamic studies:

    • Track metabolic shifts during infection progression

    • Monitor nutrient acquisition in different intracellular compartments

    • Assess adaptation to nutrient limitation in various host environments

Such integrated approaches could reveal how BAB2_1051-mediated peptide transport connects to broader adaptive responses during infection, potentially identifying metabolic vulnerabilities that could be targeted therapeutically.

How can advanced structural biology techniques inform BAB2_1051 inhibitor design for therapeutic applications?

Membrane transport proteins like BAB2_1051 represent challenging but promising targets for structure-based drug design. Advanced structural biology techniques can significantly accelerate inhibitor development through the following methodological framework:

  • High-resolution structure determination:

    • Cryo-electron microscopy for membrane protein complexes

    • X-ray crystallography of stabilized protein forms

    • NMR approaches for dynamic regions and ligand interactions

  • Structure-guided virtual screening:

    • Molecular docking of compound libraries to identified binding pockets

    • Pharmacophore modeling based on substrate interactions

    • Fragment-based drug discovery to identify initial binding scaffolds

  • Structure-activity relationship development:

    • Systematic modification of lead compounds

    • Binding affinity and functional inhibition correlations

    • Optimization for selectivity, bioavailability, and toxicity profiles

  • Validation and refinement cycle:

Validation MethodPurposeOutcome MeasuresAdvanced Applications
Binding assaysConfirm direct interactionKd, Kon/Koff ratesSurface plasmon resonance, isothermal titration calorimetry
Functional transport assaysAssess inhibition potencyIC50, mechanism of inhibitionLiposome-reconstituted transport systems
Cellular infection modelsEvaluate efficacy in contextBacterial survival, host cell responsesHigh-content imaging, real-time monitoring
Animal infection modelsValidate in vivo activityBacterial burden, survival, immune responsePK/PD correlation studies

The methodological approaches used for developing vaccines against Brucella could inform inhibitor design strategies. The research with rOmp31 demonstrated that specific peptide regions (amino acids 48-74) could induce protection similar to the full protein , suggesting that targeting critical functional domains of BAB2_1051 might be sufficient for effective inhibition.

What emerging technologies could transform research on BAB2_1051 and related Brucella transport proteins?

The field of bacterial membrane protein research is rapidly evolving, with several emerging technologies poised to advance our understanding of proteins like BAB2_1051:

  • CRISPR-Cas9 genome editing for precise modification of transport systems

  • Single-molecule tracking technologies to visualize transport dynamics in live cells

  • Nanobody-based probes for conformation-specific targeting of transport proteins

  • AI-driven protein structure prediction tools like AlphaFold2 for previously uncharacterized transporters

  • Organoid and microfluidic infection models to better recapitulate host-pathogen interactions

These technologies could help resolve longstanding questions about the role of BAB2_1051 in Brucella physiology and pathogenesis, potentially leading to novel therapeutic strategies against brucellosis.

How might BAB2_1051 research contribute to broader understanding of bacterial transport systems?

Research on BAB2_1051 extends beyond Brucella-specific applications, potentially informing our understanding of bacterial transport systems more generally. Peptide transporters are widespread among bacterial pathogens and often share structural and functional similarities despite sequence divergence.

Comparative studies between BAB2_1051 and related transporters in other pathogens could reveal:

  • Conserved mechanisms of substrate recognition and transport

  • Common regulatory patterns in response to environmental signals

  • Evolutionary adaptations to specific host environments

  • Shared vulnerabilities that could be targeted by broad-spectrum antimicrobials

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.