Recombinant Brucella abortus sn-glycerol-3-phosphate transport system permease protein ugpA (ugpA)

What is the molecular characterization of Brucella abortus ugpA protein?

The ugpA protein from Brucella abortus (strain 2308) is a sn-glycerol-3-phosphate transport system permease protein with 293 amino acids. Its molecular structure includes transmembrane domains characteristic of membrane transport proteins. The complete amino acid sequence is: MQKVTFPNKILPYFLLAPQIVLTVVFFFWPASQAIYQSFMREDAFGLKSTFVELANFTAVLSDPNYLHSVQVTVVFNVLTALLAMGVALLLATAADRVIRGQTFYRTLLIWPYAVAPAVAGMLWLFIFINPAMGTFAYLLRRNGIAWD PLLDGNQAMGLVVVAAAWKQISYNFLFFVAGLQAIPKSLIEAAAIDGARGARRFWTIVFPLLAPTSFFLLVVNTVYAFFDTFGIIHAVTGGGPAKATETLVYKVYNDGFVNLNLGSSSAQSVILMAIVIALTAFQFRFVEKRVHYS .

The protein is typically expressed as a recombinant form with applicable tags determined during the production process, which facilitates purification and functional studies. The structural analysis suggests ugpA forms part of the membrane transport complex involved in nutrient acquisition, which could be significant for bacterial survival in host environments.

What experimental models are suitable for studying ugpA function?

Several experimental models can be employed to study ugpA function, based on methodologies described for other Brucella proteins:

• Cell culture models: Macrophage-like cell lines such as J774A.1 can be used to study the role of ugpA in intracellular survival, similar to approaches used for other Brucella proteins . These models allow for assessment of bacterial intracellular growth and trafficking.

• Gene knockout studies: Generation of ugpA deletion mutants through approaches similar to those used for other Brucella genes (such as the Omp19 deletion described in search result ) can help determine the protein's role in bacterial physiology and virulence.

• Mouse infection models: BALB/c mice have been successfully used to study Brucella infections . Similar models could be adapted to study ugpA mutants, comparing colonization, persistence, and host immune responses between wild-type and mutant strains.

• Biochemical transport assays: In vitro systems to measure sn-glycerol-3-phosphate transport can directly assess ugpA function in membrane vesicles or reconstituted systems.

For gene knockout studies, researchers should consider using overlapping PCR methods and suicide vectors like pK18mobSacB, which have proven effective for generating unmarked chromosomal mutations in Brucella .

What are optimal methods for recombinant ugpA expression and purification?

Recombinant ugpA expression and purification require specialized approaches due to its membrane protein nature. Based on current protein expression technologies and the information available about ugpA's properties , the following methodological approach is recommended:

Expression Systems Comparison:

Purification Protocol:

• Membrane fraction isolation using differential centrifugation

• Solubilization with appropriate detergents (e.g., n-dodecyl-β-D-maltoside)

• Affinity chromatography using the appropriate tag (determined during production process)

• Size-exclusion chromatography for final purification

• Storage in Tris-based buffer with 50% glycerol at -20°C to maintain stability

The key consideration is maintaining the native conformation of ugpA, which is critical for functional studies. Repeated freezing and thawing should be avoided, and working aliquots should be stored at 4°C for up to one week .

How can researchers generate and validate ugpA mutants in Brucella abortus?

Generation of ugpA mutants requires precise genetic manipulation techniques. Based on methods used for other Brucella proteins, the following approach is recommended:

• Design of deletion strategy:

  • Amplify two ~500 bp DNA fragments containing the flanking regions of ugpA (BAB2_0584) from B. abortus 2308 genomic DNA

  • Design primers with appropriate restriction sites (e.g., EcoRI and BamHI)

  • Create overlapping PCR products for seamless deletion

• Vector construction and conjugation:

  • Clone the deletion construct into a suicide vector like pK18mobSacB

  • Introduce the construct into B. abortus via biparental mating

  • Select single recombinants on appropriate selective media

• Mutant selection and confirmation:

  • Use counter-selection with sucrose to identify double crossover events

  • Confirm deletion by PCR, sequencing, and western blot analysis

  • Create complemented strains using a broad-host-range plasmid containing the intact ugpA gene

• Functional validation:

  • Compare growth rates in minimal media with different carbon sources

  • Assess intracellular survival in macrophage cell lines

  • Evaluate virulence in mouse models (similar to methods used for Omp19 studies)

This methodological approach ensures the generation of reliable mutants for studying ugpA function in both in vitro and in vivo contexts.

What techniques are effective for studying ugpA protein interactions?

Understanding ugpA's protein interactions is crucial for elucidating its functional role in Brucella biology. Several complementary approaches can be employed:

• Co-immunoprecipitation (Co-IP): Similar to techniques used to identify the interaction between Cu-Zn SOD and Sar1 in Brucella , Co-IP can be used to identify ugpA interaction partners. This requires:

  • Generation of antibodies against ugpA or use of tagged recombinant versions

  • Membrane protein extraction with appropriate detergents

  • Precipitation and mass spectrometry analysis of complexes

• Bacterial two-hybrid systems: Adapted for membrane proteins to screen for potential interaction partners.

• Proximity labeling techniques: BioID or APEX2 fusions with ugpA can identify proteins in close proximity within the bacterial cell.

• Cross-linking mass spectrometry: This approach can capture transient interactions within the membrane environment.

• Fluorescence microscopy: Techniques similar to those used for visualizing Brucella in host tissues can be adapted to study ugpA localization and co-localization with other proteins:

  • Create fluorescently tagged versions of ugpA

  • Use confocal microscopy with appropriate counterstaining

  • Perform quantitative image analysis to determine co-localization coefficients

Each approach has specific advantages and limitations, and a combination of methods typically provides the most comprehensive understanding of protein interaction networks.

How does ugpA contribute to Brucella survival in different environmental conditions?

The sn-glycerol-3-phosphate transport system is likely critical for Brucella adaptation to varying nutrient conditions. Based on research on other Brucella membrane proteins, we can propose the following experimental approach to assess ugpA's role in environmental adaptation:

• Comparative growth analysis: Culture wild-type and ugpA mutant strains under various conditions:

  • Nutrient limitation

  • Different carbon sources

  • Varying pH and oxygen levels

  • Presence of host-derived antimicrobial compounds

• Stress response assessment: Similar to studies on Omp19's protection against proteolytic degradation , examine how ugpA contributes to resistance against:

  • Oxidative stress (relevant given the findings on Cu-Zn SOD )

  • Nutrient starvation

  • Antimicrobial peptides

• In vitro transport assays: Measure sn-glycerol-3-phosphate uptake rates in wild-type versus mutant strains under different environmental conditions.

• Transcriptional analysis: Assess how ugpA expression changes in response to environmental stimuli using qRT-PCR or RNA-seq approaches.

This multifaceted approach would provide comprehensive insights into ugpA's role in environmental adaptation and stress response, which are crucial aspects of Brucella pathogenesis.

What is the role of ugpA in Brucella intracellular trafficking and replication?

Intracellular trafficking and replication are critical aspects of Brucella pathogenesis. To assess ugpA's role in these processes, researchers should consider:

• Macrophage infection models: Using J774A.1 cells or primary macrophages, compare:

  • Intracellular survival rates between wild-type and ugpA mutants

  • Bacterial trafficking to the replicative niche

  • Co-localization with cellular markers

• Trafficking analysis: Similar to methods used for other Brucella proteins , use:

  • Confocal microscopy with organelle-specific markers

  • Live-cell imaging to track bacterial movement

  • Electron microscopy to visualize membrane interactions

• Host response analysis: Evaluate how ugpA affects:

  • Cytokine production

  • Cell death mechanisms (apoptosis/necrosis)

  • Intracellular signaling pathways

This approach would help determine whether ugpA, like other Brucella proteins such as Cu-Zn SOD, interacts with host cellular components to modulate intracellular trafficking and survival .

How can recombinant ugpA be utilized in Brucella vaccine development?

The potential of ugpA for vaccine development can be explored through approaches similar to those used for other Brucella proteins. Based on vaccine development strategies described in search result , the following approaches are recommended:

• Subunit vaccine development:

  • Recombinant ugpA can be formulated with appropriate adjuvants

  • Immunization protocols can be designed similar to those used for other Brucella proteins

  • Protection can be assessed through challenge studies in mouse models

• Live attenuated vaccine enhancement:

  • Consider overexpression of ugpA in attenuated strains like RB51

  • Evaluate whether this enhances protective immunity

  • Assess safety through histopathological analysis

• Vectored vaccine approaches:

  • Express ugpA in viral or bacterial vectors

  • Evaluate immunogenicity and protection

Potential advantages of ugpA-based vaccines:

• As a membrane protein, ugpA may be accessible to the immune system during infection

• Transport proteins are often conserved across strains, potentially providing broad protection

• Recombinant protein production allows for precise control of antigen quality and quantity

What is the potential of recombinant ugpA in diagnostic test development?

Recombinant ugpA offers promising applications for Brucella diagnostic test development. Based on information about recombinant protein availability and diagnostic approaches for bacterial pathogens, the following applications can be considered:

• ELISA-based diagnostics:

  • Development of ugpA-specific antibody detection assays

  • Optimization of antigen coating concentrations and buffer conditions

  • Validation using serum panels from infected and non-infected animals

• Lateral flow assays:

  • Point-of-care testing using purified recombinant ugpA

  • Development of gold nanoparticle conjugates for visual detection

• Multiplex diagnostic platforms:

  • Inclusion of ugpA alongside other Brucella antigens

  • Differential diagnosis between vaccine strains and field infections

Expected performance metrics:

These estimates are based on performance of similar recombinant protein-based diagnostics for bacterial pathogens and would require validation through experimental studies.

How should researchers interpret contradictory findings related to membrane proteins in Brucella?

Researchers often encounter contradictory findings when studying membrane proteins like ugpA. Based on approaches used in studies of other Brucella proteins , the following methodological framework is recommended:

• Context-dependent interpretation:

  • Consider experimental conditions (in vitro vs. in vivo)

  • Evaluate strain differences (laboratory vs. field isolates)

  • Assess technical variations in protein expression and purification

• Statistical approach:

  • Use appropriate statistical tests with consideration of multiple comparisons

  • Report effect sizes alongside p-values

  • Consider biological significance beyond statistical significance

• Validation strategies:

  • Employ multiple complementary techniques to verify findings

  • Use both gain-of-function and loss-of-function approaches

  • Consider conditional knockout systems for essential genes

• Collaborative verification:

  • Engage multiple laboratories to replicate key findings

  • Share standardized protocols and reagents

  • Develop community standards for reporting

What are the key considerations for experimental design when studying recombinant ugpA?

Robust experimental design is crucial for ugpA research. Based on approaches used in similar protein studies , researchers should consider:

• Controls and validations:

  • Include both positive and negative controls in all experiments

  • Validate recombinant protein identity through mass spectrometry

  • Confirm protein functionality through in vitro transport assays

• Sample size determination:

  • Perform power analysis to determine appropriate sample sizes

  • Account for variability in biological systems

  • Consider both technical and biological replicates

• Blinding and randomization:

  • Implement blinding procedures for subjective measurements

  • Randomize samples to minimize batch effects

  • Use automated analysis pipelines where possible

• Reproducibility considerations:

  • Document detailed protocols including buffer compositions

  • Report specific storage conditions and their effects on stability

  • Consider how freeze-thaw cycles affect protein activity

• Data reporting standards:

  • Follow ARRIVE guidelines for animal studies

  • Report all experimental conditions comprehensively

  • Share raw data through appropriate repositories

These considerations ensure that research on ugpA generates reliable, reproducible findings that advance our understanding of Brucella biology and pathogenesis.