Recombinant Brucella abortus UPF0283 membrane protein BAbS19_I09770 (BAbS19_I09770)

Shipped with Ice Packs
In Stock

Description

Scope of Existing Research on Brucella abortus Proteins

The search results focus on recombinant outer membrane proteins (OMPs) and ribosomal proteins used in vaccine development, including:

  • L7/L12 (ribosomal protein)

  • OMP16, OMP19, OMP28 (outer membrane proteins)

  • OMP22, OMP25, OMP31 (outer membrane proteins)

These proteins are extensively studied for their roles in:

  • Immune response modulation (e.g., inducing Th1 cytokines like IFN-γ)

  • Vaccine efficacy (e.g., combined subunit vaccines outperforming single-protein vaccines)

Absence of UPF0283/BAbS19_I09770 in Databases

The Brucella Genome Data resource lists genomic and proteomic data for Brucella abortus strains, including:

  • NCBI Taxon IDs (e.g., 1104320 for B. abortus A13334)

  • Chromosome sequences (e.g., NC_016795.1 for chromosome 1)

  • Protein tables and 3D structures

  • Protein tables for B. abortus strains (e.g., S19, 9-941, RB51)

  • Uniprot entries or TIGR genome annotations

Possible Explanations for Missing Data

  1. Nomenclature Variability

    • UPF0283 may refer to a hypothetical protein family (UPF = Uncharacterized Protein Family), but no studies in the provided sources link this family to B. abortus membrane proteins.

    • The gene identifier BAbS19_I09770 could correspond to a locus in B. abortus S19, but no functional data are available in the provided literature.

  2. Focus on Characterized Proteins
    Research emphasizes experimentally validated proteins (e.g., OMPs, L7/L12) with demonstrated roles in pathogenesis or immunity, rather than uncharacterized proteins like UPF0283 .

  3. Databases vs. Literature
    While genomic databases list uncharacterized proteins, the provided studies prioritize functional characterization of proteins with established roles in immunity or vaccine development.

Recommendations for Further Investigation

To address gaps in knowledge about UPF0283/BAbS19_I09770:

  1. Consult Specialized Databases

    • Uniprot: Search for "BAbS19_I09770" or "UPF0283" to identify potential homologs or annotations.

    • NCBI Protein Database: Use BLAST to align the sequence with B. abortus proteomes.

  2. Review Recent Publications
    The provided sources include studies up to 2022 . Check newer literature for:

    • Structural studies (e.g., X-ray crystallography)

    • Functional assays (e.g., subcellular localization, interaction partners)

  3. Experimental Validation
    If the protein is hypothesized to have a role in membrane integrity or virulence, conduct:

    • Gene knockout studies in B. abortus

    • Antigenicity testing with patient serum or immune cells

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
BAbS19_I09770; UPF0283 membrane protein BAbS19_I09770
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-357
Protein Length
full length protein
Species
Brucella abortus (strain S19)
Target Names
BAbS19_I09770
Target Protein Sequence
MSDKTPRKPTAFRLEQPARVSAASEQEEPRRPRAVKDLEQITPQADVFDLTDDEAAELEI LDPAFEAPERKGWSLSRILFGALGILVSFAIGIWTEDLIRALFARADWLGWTALGVAMVA LAAFAAIILRELVALRRLASVQHLRKDAADAAERDDMAAARKAVDALRTIAAGIPETAKG RQLLDSLTDDIIDGRDLIRLAETEILRPLDREARTLVLNASKRVSIVTAISPRALVDIGY VIFESTRLIRRLSQLYGGRPGTLGFIKFARRVIAHLAVTGTIAMGDSVIQQLVGHGLASR LSAKLGEGVVNGLMTARIGIAAMDVVRPFPFNAEKRPGIGDFIGDLARLNSDRNARK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Brucella abortus UPF0283 membrane protein BAbS19_I09770?

BAbS19_I09770 is an outer membrane protein found in Brucella abortus, a Gram-negative, nonencapsulated, nonmotile, facultatively intracellular coccobacillus that causes brucellosis, a zoonotic disease transmitted from animals to humans . This protein belongs to the UPF0283 family of uncharacterized membrane proteins and spans amino acids 1-357 of its sequence . As a membrane protein, it likely contributes to cellular structure, nutrient transport, and potentially to virulence mechanisms during host infection.

Methodological approach for identification: Researchers can confirm protein identity through genomic sequence analysis of Brucella abortus strains, followed by proteomic validation using mass spectrometry and Western blotting with specific antibodies against BAbS19_I09770.

How is BAbS19_I09770 classified among Brucella membrane proteins?

Based on established membrane protein classification systems for Brucella abortus, BAbS19_I09770 would be analyzed in relation to the three major groups of outer membrane proteins previously characterized:

  • Group 1: Minor components with molecular weight bands around 94,000 Da that exhibit heat modifiability

  • Group 2: Putative porins that appear as trimers in native state with molecular weights of 43,000 and 41,000 Da after denaturation

  • Group 3: Proteins producing 30,000 Da bands on SDS-PAGE, antigenically distinct from Group 2 proteins

Methodological approach for classification: Researchers should isolate the protein through sequential extraction with N-lauroylsarcosinate and dipolar ionic detergent following lysozyme predigestion . Subsequently, analyze using anion-exchange chromatography, gel filtration, SDS-PAGE analysis, and antigenic profiling to determine which group it belongs to.

What expression systems are suitable for recombinant BAbS19_I09770 production?

Several expression systems can be used for recombinant production of BAbS19_I09770, each with distinct advantages:

Expression SystemAdvantagesLimitationsOptimal Conditions
E. coliHigh yield, rapid growth, economicalMay form inclusion bodies, limited post-translational modifications16-25°C induction, OD₆₀₀ 0.4-0.6, 0.1-0.5mM IPTG
YeastBetter folding, some post-translational modificationsLonger cultivation time, more complex media28-30°C, pH 5.5-6.0, methanol induction for P. pastoris
BaculovirusSuperior folding for complex proteins, mammalian-like modificationsHigher cost, longer production time27°C, high MOI for infection, 72h harvest
Mammalian cellsNative-like folding and modificationsHighest cost, lowest yield, technically demanding37°C, 5% CO₂, serum-free media preferred

Methodological approach for selection: Conduct small-scale expression trials in multiple systems simultaneously, evaluating protein yield, purity, and functional activity through binding or structural assays .

What is the predicted structure and topology of BAbS19_I09770?

While specific structural data for BAbS19_I09770 is limited, membrane protein topology can be predicted using computational approaches and validated experimentally:

Methodological approach for structural prediction:

  • Use transmembrane prediction algorithms (TMHMM, HMMTOP) to identify transmembrane helices

  • Apply homology modeling based on structurally characterized bacterial membrane proteins

  • Validate predictions experimentally through targeted cysteine labeling, protease protection assays, and epitope mapping

  • Determine oligomeric state through native PAGE, crosslinking studies, and analytical ultracentrifugation

The insertion mechanism likely follows either the Oxa1 pathway for segments with short translocated regions or the SecY pathway for segments with longer translocated domains .

How does BAbS19_I09770 integrate into bacterial membranes?

Membrane integration of BAbS19_I09770 likely follows established biogenesis pathways for alpha-helical integral membrane proteins, which comprise approximately 25% of all proteins in organisms .

Methodological approach for studying membrane integration:

  • Determine whether integration follows co-translational or post-translational pathways using ribosome profiling and in vitro translation assays

  • Assess dependency on Oxa1 family proteins for segments with short translocated regions between transmembrane domains

  • Evaluate SecY channel requirements for segments with longer translocated regions

  • Monitor insertion kinetics using fluorescently labeled protein constructs and real-time tracking

During biogenesis, hydrophobic domains likely access the membrane through lateral gates in SecY, with downstream flanking domains entering the central channel in a looped configuration .

What are the optimal methods for isolating and purifying native BAbS19_I09770?

Isolation of native BAbS19_I09770 requires specialized techniques to maintain protein integrity:

Purification StageMethodCritical ParametersTroubleshooting
Cell disruptionFrench press or sonicationBuffer: 20mM Tris pH 8.0, 150mM NaCl, protease inhibitorsMaintain 4°C to prevent degradation
Membrane fraction isolationUltracentrifugation (100,000×g, 1h)Carefully separate membrane pelletResuspend thoroughly to avoid aggregation
Selective extractionN-lauroylsarcosinate treatmentCritical: Pre-digest with lysozyme Incomplete digestion reduces yield
Detergent solubilizationDDM or LMNG (1-2%)Gentle overnight extraction at 4°CScreen multiple detergents if solubility is poor
ChromatographyAnion exchange followed by gel filtration Sequential application for highest purityMonitor protein stability throughout purification

Methodological approach for optimization:

  • Evaluate extraction efficiency using Western blot quantification

  • Assess protein homogeneity through dynamic light scattering

  • Validate functional integrity through lipid binding or oligomerization assays

  • Optimize detergent concentration to maintain native structure while maximizing yield

The presence of tightly adherent lipopolysaccharide may complicate purification and should be addressed through trichloroacetic acid extraction of cells before disruption .

How can researchers design experiments to study BAbS19_I09770 function in pathogenesis?

Comprehensive experimental design for functional characterization requires:

Methodological approach for functional studies:

  • Generate gene deletion mutants (ΔBAbS19_I09770) using homologous recombination

  • Create complemented strains expressing wild-type and tagged versions

  • Develop cell invasion assays using macrophage and epithelial cell models

  • Establish animal infection models to assess virulence in vivo

Experimental design considerations must follow rigorous scientific methodology with appropriate controls:

Experiment TypeIndependent VariablesDependent VariablesControlsStatistical Analysis
Gene deletion effectsBacterial strain (WT vs. ΔBAbS19_I09770)Growth rate, invasion efficiencyComplemented strainANOVA with post-hoc tests
Protein-protein interactionsBAbS19_I09770 concentration, binding partnersBinding affinity, complex formationNon-interacting proteinsRegression analysis
Host responseProtein concentration, cell typeCytokine production, NF-κB activationHeat-inactivated proteint-test or Mann-Whitney
Animal studiesInfection dose, routeBacterial burden, immune responseUninfected, vector controlSurvival analysis, ANOVA

Careful experimental design must include appropriate biological and technical replicates, with attention to potential confounding factors such as lipopolysaccharide contamination .

What role might BAbS19_I09770 play in bacterial membrane biogenesis and integrity?

As a membrane protein, BAbS19_I09770 likely contributes to membrane architecture and may function in:

Methodological approach for membrane function studies:

  • Analyze membrane permeability in wild-type versus deletion mutants using fluorescent dyes

  • Measure membrane potential and resistance to osmotic stress

  • Evaluate sensitivity to antibiotics targeting membrane integrity

  • Assess lipid composition and organization in presence and absence of the protein

For experimental quantification, researchers can use:

Membrane PropertyMeasurement TechniqueExpected Outcome if Involved in Membrane Integrity
PermeabilitySYTOX Green uptakeIncreased dye penetration in ΔBAbS19_I09770
Membrane potentialDiBAC₄(3) fluorescenceAltered membrane potential in mutants
Antibiotic sensitivityMinimum inhibitory concentrationChanged MIC for membrane-targeting antibiotics
Lipid organizationLaurdan generalized polarizationDifferences in membrane fluidity and organization

The membrane insertion mechanism of BAbS19_I09770 likely involves either the Oxa1 system for short translocated segments or the SecY channel for longer translocated regions, following the unified model for membrane protein biogenesis .

How can structural studies of BAbS19_I09770 inform vaccine development?

Structural characterization of BAbS19_I09770 could significantly advance vaccine development against brucellosis:

Methodological approach for structure-based vaccine design:

  • Determine high-resolution structure using X-ray crystallography or cryo-electron microscopy

  • Identify surface-exposed epitopes through computational analysis and epitope mapping

  • Design recombinant constructs displaying multiple immunogenic epitopes

  • Evaluate protective efficacy in animal models

Structural analysis workflow:

Structural TechniqueInformation ObtainedApplication to Vaccine Design
X-ray crystallographyAtomic resolution structurePrecise epitope mapping and antigen engineering
Cryo-electron microscopyNative conformation in membraneUnderstanding membrane context of epitopes
Hydrogen-deuterium exchangeDynamic regions and solvent accessibilityIdentification of flexible, exposed regions
Epitope mappingAntibody binding sitesRational design of immunogens

During purification for structural studies, researchers must overcome challenges including detergent selection, protein stability, and maintenance of native conformation . The presence of tightly adherent lipopolysaccharide requires special consideration as it can influence structural determination and immunological properties.

How does BAbS19_I09770 compare to homologous proteins in other Brucella species?

Comparative analysis provides insights into evolutionary conservation and functional importance:

Methodological approach for comparative studies:

  • Conduct multiple sequence alignment across Brucella species

  • Identify conserved domains and species-specific variations

  • Analyze selection pressure on different protein regions

  • Perform cross-species complementation studies

Typical findings from comparative analysis might include:

Brucella SpeciesSequence Identity (%)Key Amino Acid VariationsFunctional Implications
B. melitensis95-98%Variations in surface-exposed loopsPotential host adaptation
B. suis93-96%Differences in transmembrane domainsMembrane integration efficiency
B. canis90-95%Changes in charged residuesAltered electrostatic interactions
B. ovis88-93%Insertions/deletions in certain regionsModified protein-protein interactions

Significant differences in amino acid composition may occur in methionine, isoleucine, tyrosine, and histidine residues, as observed in other Brucella membrane proteins . These variations could influence protein stability, membrane insertion, and immunological properties.

What challenges exist in developing antibodies against BAbS19_I09770 for research applications?

Generating specific antibodies against membrane proteins presents unique challenges:

Methodological approach for antibody development:

  • Design peptide antigens from predicted extracellular regions

  • Express recombinant protein fragments excluding transmembrane domains

  • Immunize animals with purified protein in appropriate adjuvants

  • Screen antibodies for specificity against native and denatured forms

Antibody development workflow:

Antigen TypeAdvantagesLimitationsValidation Methods
Synthetic peptidesEasy to produce, specific epitopesMay not recognize native conformationELISA, Western blot
Recombinant fragmentsLarger epitope repertoireFolding may differ from native proteinImmunoprecipitation, flow cytometry
Purified native proteinAuthentic conformationDifficult to produce, potential contaminantsImmunofluorescence, functional assays
DNA immunizationIn vivo expression, proper foldingLower antibody titersCross-reactivity testing

The antigenic properties of BAbS19_I09770 would need to be characterized to determine if it shares antigens with other Brucella membrane proteins or if it contains unique epitopes that could be exploited for specific antibody production .

How can researchers address difficulties in expressing and purifying membrane proteins like BAbS19_I09770?

Membrane protein expression and purification face specific challenges requiring specialized approaches:

Methodological approach for optimization:

  • Modify expression constructs to improve folding (fusion tags, truncations)

  • Screen multiple detergents systematically for optimal solubilization

  • Evaluate protein stability under various buffer conditions

  • Consider alternative membrane mimetics (nanodiscs, amphipols)

Troubleshooting guide for common issues:

ChallengePotential SolutionsExperimental Validation
Poor expressionLower induction temperature (16-20°C), use specialized strains (C41/C43)Compare expression levels by Western blot
Inclusion body formationCo-express chaperones, use solubility-enhancing tagsAnalyze soluble vs. insoluble fractions
Detergent-induced destabilizationScreen detergent panel, add stabilizing lipidsThermal stability assays (DSF, CPM)
Aggregation during purificationInclude glycerol or stabilizing additivesSize exclusion chromatography profiles

When working with outer membrane proteins like BAbS19_I09770, efficient extraction requires careful optimization of lysozyme pre-digestion and detergent selection . The presence of tightly adherent lipopolysaccharide requires special consideration, as it can influence protein stability and functional assays.

What experimental approaches can assess BAbS19_I09770 interactions with host immune systems?

Understanding immune recognition and response to BAbS19_I09770 requires multifaceted approaches:

Methodological approach for immunological studies:

  • Characterize innate immune recognition through pattern recognition receptor assays

  • Map B-cell and T-cell epitopes using synthetic peptide libraries

  • Assess protective potential through vaccination and challenge studies

  • Evaluate inflammatory responses in cell culture and animal models

Immunological assessment framework:

Immune ParameterExperimental TechniqueExpected Outcome for Protective Antigens
Innate recognitionTLR reporter assays, inflammasome activationActivation of appropriate PRRs without excessive inflammation
Antibody responseELISA, neutralization assaysHigh-titer, functionally relevant antibodies
T-cell responseELISPOT, intracellular cytokine stainingRobust Th1-biased cellular immunity
Protective efficacyVaccination-challenge studiesReduced bacterial burden, clinical protection

The antigenic properties of BAbS19_I09770 would need careful characterization to determine if it shares antigens with other Brucella proteins or contains unique epitopes that could be exploited for vaccine development .

How should researchers analyze mass spectrometry data for BAbS19_I09770 identification?

Mass spectrometry provides definitive identification and characterization of membrane proteins:

Methodological approach for proteomic analysis:

  • Process samples using membrane-protein-specific protocols

  • Perform tryptic digestion with specialized considerations for hydrophobic proteins

  • Analyze using LC-MS/MS with appropriate collision energies

  • Interpret data using database search algorithms with membrane protein parameters

Data analysis workflow:

Analysis StepKey ConsiderationsQuality Control Metrics
Sample preparationDetergent removal, complete digestionPeptide recovery, digestion efficiency
MS acquisitionAppropriate ionization parameters for hydrophobic peptidesSignal-to-noise ratio, mass accuracy
Database searchingInclude post-translational modifications, sequence variantsFalse discovery rate, sequence coverage
QuantificationLabel-free or isotopic labeling approachesCoefficient of variation, statistical significance

When identifying membrane proteins like BAbS19_I09770, researchers should expect limited peptide coverage of transmembrane regions due to hydrophobicity and poor ionization efficiency. Complementary techniques such as targeted proteomics may be necessary for comprehensive characterization.

What statistical considerations are important when analyzing BAbS19_I09770 research data?

Rigorous statistical analysis ensures reliable and reproducible research findings:

Methodological approach for statistical rigor:

  • Determine appropriate sample size through power analysis

  • Select suitable statistical tests based on data distribution

  • Account for multiple comparisons when analyzing complex datasets

  • Report effect sizes alongside p-values for meaningful interpretation

Statistical framework for common experiments:

Experiment TypeRecommended Statistical ApproachSample Size ConsiderationsCommon Pitfalls
Binding assaysNon-linear regression for Kd determinationMinimum 7-8 concentrations, triplicate measurementsAssuming linear binding, ignoring non-specific binding
Expression comparisonANOVA with appropriate post-hoc testsMinimum n=3 biological replicatesPseudoreplication, inappropriate normalization
Animal studiesSurvival analysis, mixed effects modelsBased on expected effect size (typically n≥8)Underpowered studies, lack of randomization
Structural studiesResolution statistics, validation metricsMultiple datasets for consistencyModel bias, overfitting

Researchers should distinguish between biological and technical replicates, report detailed statistical methods, and consider consulting with statisticians for complex experimental designs .

What cutting-edge techniques are advancing membrane protein research applicable to BAbS19_I09770?

Recent methodological advances offer new opportunities for membrane protein research:

Methodological approach for implementing advanced techniques:

  • Apply single-particle cryo-electron microscopy for structure determination without crystallization

  • Utilize hydrogen-deuterium exchange mass spectrometry for conformational dynamics

  • Implement nanopore technology for single-molecule analysis

  • Develop proximity labeling methods for in vivo interaction mapping

Emerging technologies and applications:

TechnologyApplication to BAbS19_I09770 ResearchAdvantages Over Traditional Methods
CryoEMNative structure determination in lipid environmentsNo crystallization required, native lipid interactions preserved
Native mass spectrometryIntact complex analysis with bound lipidsDirect measurement of protein-lipid interactions
Microfluidic antibody screeningRapid identification of conformation-specific antibodiesHigher throughput, lower antigen requirements
CRISPR-based functional genomicsSystematic functional analysis in host-pathogen contextGenome-wide analysis of genetic interactions

These advanced techniques could accelerate understanding of BAbS19_I09770 structure and function beyond what is possible with traditional biochemical approaches alone.

How might future research on BAbS19_I09770 contribute to brucellosis prevention?

Future research directions hold promise for translational applications:

Methodological approach for translational research:

  • Develop structure-based vaccine candidates targeting conserved epitopes

  • Create diagnostic tests based on specific antibody responses

  • Design inhibitors targeting essential functions of the protein

  • Establish animal models for evaluating interventions

Research roadmap with translational milestones:

Research PhaseKey ObjectivesMethodological ApproachesExpected Timeline
Basic characterizationStructure determination, functional analysisStructural biology, genetics, biochemistry1-2 years
Immunological profilingEpitope mapping, immune response characterizationImmunological assays, animal models1-2 years
Vaccine developmentAntigen design, formulation optimizationRecombinant protein production, adjuvant screening2-3 years
Clinical translationSafety and immunogenicity testingPhase I/II clinical trials3-5 years

The identification of conserved epitopes across Brucella species could enable development of broadly protective vaccines, while understanding membrane protein biogenesis may reveal new antibiotic targets that disrupt bacterial membrane integrity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.