Recombinant Brucella canis ATP synthase subunit a (atpB)

What is the molecular composition of recombinant Brucella canis ATP synthase subunit a (atpB)?

Recombinant Brucella canis ATP synthase subunit a (atpB) is a full-length protein (249 amino acids) typically fused with an N-terminal His tag for purification purposes. The protein is encoded by the atpB gene (BCAN_A0387) and corresponds to UniProt ID A9M8F8. The complete amino acid sequence is: MANDPIHQFQVSRWIPIDVGGVDLSFTNVSAFMVATVVLASGFLYLTSSGRGLIPTRLQSVSEMAYEFVATSLRDSAGSKGMKFFPFVFSLFMFVLVANFIGLFPYFYTVTSQIIVTFALSLLVIGTVIFYGFFKHGFGFLKLFVPSGVPGIIVPLVVLIEIISFLSRPISLSVRLFANMLAGHITLKVFAGFVVSLSSLGALGIGGAVLPLLMTVAITALEFLVAFLQAYVFTVLTCMYINDAVHPGH . This recombinant protein is typically expressed in E. coli and purified to greater than 90% purity as determined by SDS-PAGE .

What are the optimal storage and handling conditions for recombinant atpB?

For long-term stability, recombinant atpB should be stored at -20°C or -80°C. The protein is typically supplied as a lyophilized powder in a Tris-based buffer with 6% Trehalose at pH 8.0 . For reconstitution, it is recommended to centrifuge the vial briefly before opening and reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For extended storage, adding glycerol to a final concentration of 5-50% is recommended . Working aliquots can be stored at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided as they can compromise protein integrity . These storage parameters are critical for maintaining structural integrity and functional activity for experimental applications.

What purification strategies are most effective for obtaining high-quality recombinant atpB protein?

The most effective purification strategy for recombinant Brucella canis atpB leverages the N-terminal His-tag typically incorporated into expression constructs . A recommended multi-step purification protocol includes:

• Initial capture using immobilized metal affinity chromatography (IMAC) with Ni-NTA or similar resin

• Buffer exchange to remove imidazole using dialysis or size exclusion chromatography

• Optional secondary purification step using ion exchange chromatography if higher purity is required

• Quality assessment using SDS-PAGE to confirm >90% purity

When designing purification protocols, researchers should consider the membrane protein nature of atpB, which may necessitate the inclusion of appropriate detergents to maintain solubility. The final preparation should be stored in Tris-based buffer with 6% Trehalose at pH 8.0 or with 50% glycerol for optimal stability . Validation of the purified protein's integrity through circular dichroism or functional assays is recommended before proceeding to experimental applications.

How can researchers effectively validate the structural integrity of purified recombinant atpB?

Validating structural integrity of recombinant Brucella canis atpB requires a multi-faceted approach:

• Circular Dichroism (CD) Spectroscopy: To assess secondary structure elements characteristic of membrane proteins with alpha-helical transmembrane domains

• Thermal Shift Assays: To evaluate protein stability and proper folding by monitoring denaturation profiles

• Limited Proteolysis: To probe the accessibility of cleavage sites as an indicator of proper folding

• Reconstitution into Liposomes: To verify membrane insertion capability and proton channel functionality

• Antibody Recognition: Using conformation-specific antibodies to confirm native-like epitope presentation

For membrane proteins like atpB, particular attention should be paid to detergent selection during these analyses, as improper detergent conditions can disrupt native structure. Additionally, researchers should consider that the N-terminal His-tag may influence certain structural characteristics, and tag removal might be necessary for specific applications requiring native-like properties .

What expression systems yield optimal quantities of functional recombinant atpB?

• Strain Selection: BL21(DE3) derivatives with enhanced membrane protein expression capabilities, such as C41(DE3) or C43(DE3)

• Vector Design: Incorporation of N-terminal His-tags for purification while ensuring minimal interference with protein folding

• Expression Conditions: Lower induction temperatures (16-25°C) and reduced inducer concentrations to slow expression and facilitate proper membrane insertion

• Media Formulation: Enriched media containing glycerol and specific ion supplements that support membrane protein biosynthesis

• Co-expression Strategies: Introduction of chaperones or components of membrane insertion machinery to enhance proper folding

Expression yields can be monitored through Western blot analysis using anti-His antibodies, while functionality assessment may require reconstitution into membrane mimetic systems. The recombinant protein should achieve >90% purity following appropriate purification protocols , with typical yields ranging from 1-5 mg per liter of bacterial culture depending on optimization parameters.

What experimental approaches can assess the role of atpB in bacterial membrane potential maintenance?

To investigate atpB's contribution to membrane potential in Brucella canis, researchers should implement a multi-methodological approach:

• Fluorescent Probe Analysis: Using voltage-sensitive dyes (e.g., DiSC3(5), JC-1) to quantify membrane potential in wild-type versus atpB-depleted or inhibited bacteria

• Patch-Clamp Electrophysiology: Applied to bacterial spheroplasts or reconstituted liposomes containing purified recombinant atpB to measure proton translocation directly

• pH-Sensitive Fluorophores: Incorporating pH-sensitive reporters into reconstituted proteoliposomes to monitor proton movement associated with atpB function

• Genetic Complementation Studies: Using controlled expression systems to correlate atpB levels with membrane potential recovery in depleted strains

• Inhibitor-Based Approaches: Employing ATP synthase inhibitors with varying mechanisms to differentiate atpB-specific effects from those on other ATP synthase components

These methodologies should be performed under conditions mimicking the intracellular environment encountered during infection, including acidic pH and limited nutrient availability. Control experiments should include parallel analysis of related ATP synthase components to establish functional relationships within the complex. Data interpretation should consider that complete abolishment of atpB function may be lethal, necessitating careful titration of expression or inhibition levels.

How can researchers investigate potential interactions between atpB and the MucR regulatory network?

Recent studies have identified MucR as an important transcriptional regulator in Brucella canis that influences stress responses and virulence . Investigating potential regulatory connections between MucR and atpB requires systematic experimental approaches:

• Transcriptional Analysis: Quantitative RT-PCR or RNA-seq comparing atpB expression levels between wild-type and MucR-deficient strains under various stress conditions (heat, iron limitation, antibiotic exposure)

• Promoter Binding Studies: Chromatin immunoprecipitation (ChIP) assays to determine whether MucR directly binds to the atpB promoter region

• Reporter Constructs: Creating atpB promoter-reporter fusions to monitor expression changes in response to MucR modulation

• Protein-Protein Interaction Analysis: Co-immunoprecipitation or bacterial two-hybrid assays to identify potential direct interactions between MucR and components of ATP synthase regulatory mechanisms

• Metabolic Profiling: Comparative metabolomics of wild-type and MucR-deficient strains to identify changes in energy-related metabolites that might link to ATP synthase function

This investigation is particularly relevant given RNA-seq data showing that MucR deletion affects genes involved in energy production and conversion in Brucella canis . The established role of MucR in stress resistance (heat, iron limitation, antibiotics) overlaps with conditions where ATP synthase function is critical, suggesting potential regulatory connections that remain to be fully characterized.

What sequence conservation patterns exist in atpB across different Brucella species and related alpha-proteobacteria?

Analysis of atpB sequence conservation reveals important evolutionary patterns that reflect functional constraints and adaptation. The 249-amino acid sequence of Brucella canis atpB serves as a reference point for comparative analysis:

The high conservation within Brucella reflects the essential nature of ATP synthase function and the close evolutionary relationships within this genus. Conservation patterns align with functional constraints: residues involved in proton translocation and subunit interactions show higher conservation than peripheral regions. These patterns provide insights into structure-function relationships and potential targets for species-specific interventions. The evolutionary conservation also suggests that findings regarding atpB function in model Brucella species likely apply to B. canis, despite limited direct experimental evidence.

How do structural features of atpB contribute to its functional role in different bacterial environments?

The structural features of Brucella canis atpB are intimately connected to its function in proton translocation across the bacterial membrane. Based on sequence analysis and comparison with homologous proteins, several key structural elements can be identified:

• Transmembrane Helices: Multiple hydrophobic segments form alpha-helical transmembrane domains that anchor the protein in the bacterial membrane and create the proton channel

• Proton-Binding Sites: Specific charged residues positioned within the transmembrane regions that facilitate proton movement through the membrane

• Subunit Interface Regions: Surfaces that interact with other ATP synthase components to form the functional complex

• Environment-Responsive Elements: Regions that undergo conformational changes in response to proton gradients or pH variations

What are the potential applications of recombinant atpB in vaccine development research?

Recombinant Brucella canis atpB holds several promising applications for vaccine research:

• Subunit Vaccine Component: As a membrane protein with potential immunogenicity, atpB could serve as a component in subunit vaccine formulations against brucellosis

• Adjuvant Development: The protein's membrane-associated nature may provide inherent adjuvant properties that could enhance immune responses to co-administered antigens

• Live-Attenuated Vaccine Strain Development: Targeted modification of atpB expression could contribute to creating attenuated strains with reduced virulence but maintained immunogenicity

• Correlates of Protection Studies: Measuring immune responses to atpB could help establish correlates of protection following vaccination or natural infection

• Cross-Protection Analysis: Determining whether immune responses to atpB provide protection against multiple Brucella species due to sequence conservation

While direct evidence for atpB's immunogenicity in B. canis is limited, research on homologous proteins in other pathogens suggests potential utility in vaccine development. Any vaccine application would require thorough evaluation of protective efficacy, safety, and the nature of the immune response elicited. The availability of purified recombinant protein facilitates these investigations by providing material for immunization studies and immunological assays.

How can recombinant atpB contribute to the development of novel diagnostic approaches for brucellosis?

Recombinant Brucella canis atpB offers several promising avenues for diagnostic development:

• Serological Assay Antigen: The purified recombinant protein could serve as a capture antigen in ELISA or other immunoassay formats to detect anti-Brucella antibodies in clinical samples

• Multiplex Diagnostic Platforms: atpB could be incorporated alongside other Brucella antigens in multiplex assays to improve sensitivity and specificity of serological testing

• Lateral Flow Device Development: The recombinant protein could be adapted for rapid point-of-care testing applications, particularly valuable in resource-limited settings

• Species-Specific Diagnostics: If unique epitopes exist in B. canis atpB, these could be exploited to develop tests that distinguish B. canis infection from other Brucella species

• Cell-Mediated Immunity Assessment: Beyond antibody detection, recombinant atpB could be used to develop assays measuring T-cell responses, potentially distinguishing active from past infections

While specific diagnostic applications of atpB have not been directly reported, other recombinant Brucella proteins have been successfully employed in diagnostic ELISA development. Before clinical implementation, extensive validation would be necessary, including assessment of sensitivity, specificity, and cross-reactivity with other pathogens. Such validation would require testing with well-characterized serum panels from confirmed Brucella infections and appropriate controls.

What challenges must be addressed when developing atpB-targeted antimicrobial strategies?

Developing antimicrobial strategies targeting Brucella canis atpB presents several significant challenges that researchers must address:

• Selectivity Barriers: Achieving selective inhibition of bacterial ATP synthase while avoiding host mitochondrial ATP synthase, despite evolutionary conservation of functional domains

• Membrane Penetration: Designing inhibitors capable of crossing the bacterial outer membrane to reach the inner membrane-embedded atpB target

• Resistance Development: Addressing the potential for resistance emergence through mutations in atpB or compensatory changes in energy metabolism pathways

• Intracellular Delivery: Ensuring that inhibitors can access the intracellular niche where Brucella resides during infection

• Structure-Based Design Limitations: Overcoming challenges in obtaining high-resolution structural data for membrane proteins like atpB to guide rational drug design

Despite these challenges, ATP synthase remains an attractive antimicrobial target due to its essential role in bacterial energy metabolism. Precedent exists in other pathogens, with ATP synthase inhibitors being developed against Mycobacterium tuberculosis. Successful development strategies might include combination approaches with conventional antibiotics or targeting Brucella-specific aspects of ATP synthase regulation or assembly. Research using purified recombinant atpB could facilitate screening for selective inhibitors and characterization of inhibitor binding modes.