Recombinant Brucella canis ATP synthase subunit b 1 (atpF1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for customers.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If a specific tag is required, please inform us for preferential development.
Synonyms
atpF1; BCAN_A0389; ATP synthase subunit b 1; ATP synthase F(0 sector subunit b 1; ATPase subunit I 1; F-type ATPase subunit b 1; F-ATPase subunit b 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-208
Protein Length
full length protein
Species
Brucella canis (strain ATCC 23365 / NCTC 10854)
Target Names
atpF1
Target Protein Sequence
MFVSTAFAQTATESQPASTAGEHGAADAVHTETGVAHDAGHGSGVFPPFDSTHYASQVLW LAITFGLFYLFLSRVVLPRIGGVIETRRDRIAQDLEQAARLKQDADNAIAAYEQELAQAR SKAASIAEAAREKGKGEADAERASAEAVLESKLKEAEERIAAIKAKAMSDVGNIAEETTA TIVEQLLGLTADKASVSEAVKAIRASNA
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F(1) catalytic core (extramembraneous) and the F(0) membrane proton channel, connected by a central and peripheral stalk. ATP synthesis in the F(1) catalytic domain is coupled, via a rotary mechanism involving the central stalk subunits, to proton translocation. This subunit is a component of the F(0) channel, forming part of the peripheral stalk and linking F(1) to F(0).
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the basic structure and function of Brucella canis ATP synthase subunit b 1?

Brucella canis ATP synthase subunit b 1 (atpF1) is a 208-amino acid protein that functions as a critical component of the F0F1 ATP synthase complex. The protein is encoded by the atpF1 gene (also known as BCAN_A0389) and serves as a structural element in the F0 sector of ATP synthase. The complete amino acid sequence is: MFVSTAFAQTATESQPASTAGEHGAADAVHTETGVAHDAGHGSGVFPPFDSTHYASQVLWLAITFGLFYLFLSRVVLPRIGGVIETRRDRIAQDLEQAARLKQDADNAIAAYEQELAQARSKAASIAEAAREKGKGEADAERASAEAVLESKLKEAEERIAAIKAKAMSDVGNIAEETTATIVEQLLGLTADKASVSEAVKAIRASNA .

As part of the ATP synthase complex, atpF1 participates in the molecular machinery that harnesses the proton gradient across the bacterial membrane to synthesize ATP, the primary energy currency of the cell. This function is essential for bacterial energy metabolism and survival, particularly under stress conditions encountered during host infection.

How do researchers produce recombinant Brucella canis atpF1 for laboratory studies?

Recombinant B. canis atpF1 is typically produced using E. coli expression systems. The methodology involves:

  • Gene cloning and vector construction: The atpF1 gene sequence is amplified from B. canis genomic DNA and inserted into an appropriate expression vector containing a His-tag sequence for later purification.

  • Protein expression: The recombinant vector is transformed into E. coli host cells (frequently BL21 or similar strains) and protein expression is induced using IPTG or other induction methods appropriate for the chosen expression system .

  • Protein purification: The expressed protein is typically purified using affinity chromatography (commonly Ni-NTA for His-tagged proteins), followed by additional purification steps if necessary to achieve high purity (>90% as determined by SDS-PAGE) .

  • Quality control: The purified protein undergoes validation through SDS-PAGE, Western blotting, and sometimes mass spectrometry to confirm identity and purity .

The final product is often provided as a lyophilized powder containing buffer components and stabilizers such as trehalose to maintain protein integrity during storage and shipping .

What are the optimal storage and handling conditions for recombinant Brucella canis atpF1?

For optimal preservation of recombinant B. canis atpF1 activity and structure:

  • Long-term storage: Store lyophilized protein at -20°C or -80°C upon receipt. For prepared aliquots, storage at -80°C is recommended for maximum stability .

  • Reconstitution protocol:

    • Briefly centrifuge the vial before opening to collect all material at the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (typically 50% is recommended) to prevent freeze-thaw damage

  • Working aliquots: Store working aliquots at 4°C for up to one week to minimize freeze-thaw cycles .

  • Stability considerations: Avoid repeated freeze-thaw cycles as they significantly degrade protein quality. Aliquoting immediately after reconstitution is strongly recommended for materials intended for multiple experiments .

  • Buffer compatibility: The protein is typically provided in Tris/PBS-based buffer with 6% trehalose at pH 8.0, which should be considered when designing experiments to avoid buffer incompatibilities .

How can recombinant Brucella canis atpF1 be utilized in immunological research?

Recombinant B. canis atpF1 can be employed in various immunological research applications:

  • Serological assay development:

    • ELISA development for detecting anti-atpF1 antibodies in infected hosts

    • Western blot analysis to evaluate antibody specificity and cross-reactivity

    • Protein microarrays for multiplex detection of Brucella infection biomarkers

  • Vaccination studies:

    • As a subunit vaccine candidate, either alone or in combination with other immunogenic Brucella proteins

    • For evaluation of both humoral and cell-mediated immune responses

    • In challenge studies to assess protective efficacy against B. canis infection

  • T-cell response analysis:

    • For identification of T-cell epitopes using peptide mapping approaches

    • In lymphocyte proliferation assays to assess cellular immunity

    • For cytokine profiling following stimulation of immune cells with the recombinant protein

Methodology example for ELISA development:

  • Coat microplate wells with purified recombinant atpF1 (typically 1-5 μg/mL)

  • Block with appropriate buffer (e.g., BSA or non-fat milk)

  • Incubate with serially diluted test sera

  • Detect with species-appropriate secondary antibody conjugates

  • Compare results with established serological markers to assess diagnostic potential

While direct data for B. canis atpF1 immunogenicity is still developing, related ATP synthase subunits have demonstrated potential as serological markers in similar pathogens.

What methods are effective for studying atpF1's role in Brucella canis virulence and pathogenesis?

Several methodological approaches can be employed to investigate atpF1's contribution to B. canis virulence:

  • Gene knockout/knockdown strategies:

    • CRISPR-Cas9 or homologous recombination-based gene deletion

    • Conditional expression systems to study essential genes

    • RNA interference for transient knockdown studies

  • Cellular infection models:

    • Macrophage infection assays to assess intracellular survival and replication

    • Evaluation of ATP production in wild-type vs. atpF1-deficient strains

    • Membrane potential analysis using fluorescent probes

    • Acid resistance assays to assess survival in phagolysosomal environments

  • Comparative proteomic approaches:

    • Quantitative proteomics to measure changes in protein expression profiles

    • Protein-protein interaction studies to identify binding partners

    • Post-translational modification analysis

  • Structural and functional assays:

    • ATP synthesis activity measurements in membrane preparations

    • Proton translocation assays

    • Structural studies using X-ray crystallography or cryo-EM to understand the role of atpF1 in the ATP synthase complex

Comparative proteomic data from related Brucella species indicates that ATP synthase subunits undergo significant regulation during infection, with fold changes ranging from -2.6 to -6.7 in attenuated strains, suggesting critical roles in virulence.

How can researchers differentiate between the functions of ATP synthase subunits in different Brucella species?

To differentiate ATP synthase subunit functions across Brucella species, researchers can employ:

  • Sequence and structural comparison approaches:

    • Multiple sequence alignment to identify conserved and variable regions

    • Homology modeling for structural prediction and comparison

    • Phylogenetic analysis to understand evolutionary relationships

  • Functional complementation studies:

    • Cross-species gene complementation in knockout strains

    • Chimeric protein expression with domains from different species

    • Heterologous expression systems to assess functional conservation

  • Species-specific antibody development:

    • Identification of species-specific epitopes through epitope mapping

    • Production of monoclonal antibodies targeting unique regions

    • Immunoprecipitation studies to identify species-specific interaction partners

  • Comparative transcriptomics and proteomics:

    • RNA-Seq analysis under identical growth conditions across species

    • Quantitative proteomics to compare expression levels and regulation

    • Post-translational modification profiling

When designing these experiments, it's important to note that while B. canis atpF1 shares considerable homology with other Brucella species, sequence variations may contribute to species-specific functions or regulations. No cross-reactivity was observed between B. canis and other Brucella species in recent detection method development, highlighting potential molecular distinctions that could be exploited for species differentiation .

How does atpF1 contribute to Brucella canis survival under host stress conditions?

ATP synthase subunit b 1 (atpF1) plays critical roles in Brucella survival under various host stress conditions:

  • Acid stress response:

    • ATP synthase components help maintain intracellular pH homeostasis

    • By contributing to proton gradient management, atpF1 indirectly supports bacterial survival in the acidic phagosomal environment

    • Downregulation of ATP synthase components in attenuated Brucella strains correlates with reduced survival under acidic conditions

  • Nutrient limitation adaptation:

    • ATP production efficiency becomes crucial during nutrient restriction in host cells

    • The intact ATP synthase complex ensures energy availability for essential processes

    • Studies in related Brucella species show that atpD downregulation alters fatty acid metabolism and amino acid transport, compromising bacterial fitness

  • Oxidative stress resistance:

    • Energy production supports antioxidant defense mechanisms

    • ATP-dependent repair systems require functional ATP synthase for damage remediation

    • The maintenance of membrane potential, which depends partly on ATP synthase function, affects resistance to host antimicrobial peptides

  • Intracellular trafficking:

    • Energy requirements for intracellular survival and trafficking are substantial

    • ATP synthase function supports protein secretion systems needed for virulence

    • Membrane integrity, influenced by energy metabolism, affects vesicular trafficking

Experimental approaches to study these processes include:

  • Membrane potential measurements using fluorescent probes

  • ATP quantification under various stress conditions

  • Survival assays in macrophages with chemical inhibitors of ATP synthase

  • Transcriptomic and proteomic analysis of stress responses in wild-type versus attenuated strains

What are the methodological challenges in studying the structural biology of membrane-associated ATP synthase components like atpF1?

Investigating membrane-associated proteins like atpF1 presents several methodological challenges:

The full-length B. canis atpF1 sequence has been expressed with N-terminal His-tags, providing a starting point for structural studies, though comprehensive structural characterization remains to be completed .

How can recombinant atpF1 be utilized in developing novel detection methods for Brucella canis infection?

Recombinant atpF1 offers several avenues for developing innovative B. canis detection platforms:

  • Serological diagnostic development:

    • ELISA-based detection using recombinant atpF1 as a capture antigen

    • Lateral flow assays for point-of-care testing

    • Bead-based multiplex assays combining multiple Brucella antigens

    • Methodology: Optimize antigen coating concentration (typically 1-10 μg/mL) and validate with known positive and negative sera panels

  • Nucleic acid amplification techniques:

    • The atpF1 gene sequence can serve as a target for PCR-based detection

    • Novel isothermal amplification methods such as recombinase-aided amplification (RAA) can be developed

    • Highly sensitive detection systems can achieve sensitivity of 1 copy/mL with properly designed primers and probes

  • Aptamer development:

    • SELEX (Systematic Evolution of Ligands by Exponential Enrichment) using recombinant atpF1 as target

    • Aptamer-based electrochemical biosensors for rapid detection

    • Methodology: Multiple selection rounds with increasing stringency, followed by sequencing and binding affinity determination

  • Mass spectrometry-based approaches:

    • Targeted proteomics assays using signature peptides from atpF1

    • MALDI-TOF MS for rapid bacterial identification

    • Methodology: Develop multiple reaction monitoring (MRM) assays for specific peptides unique to B. canis atpF1

Recent research has demonstrated that recombinase-aided amplification technology targeting Brucella genes provides superior sensitivity compared to commercial qPCR methods (100% vs. 86.96% detection rate), indicating that well-designed molecular assays can significantly improve diagnostic outcomes .

What are the most promising future research directions for studying atpF1's role in Brucella canis?

Several high-priority research directions for B. canis atpF1 include:

  • Structural biology approaches:

    • Cryo-EM studies of the complete ATP synthase complex

    • Structural comparison across Brucella species to identify species-specific features

    • Structure-guided drug design targeting unique features of atpF1

  • Host-pathogen interaction studies:

    • Investigation of potential atpF1 interactions with host factors

    • Examination of atpF1 regulation during different stages of infection

    • Identification of post-translational modifications that occur during infection

  • Systems biology integration:

    • Multi-omics approaches combining transcriptomics, proteomics, and metabolomics

    • Network analysis to position atpF1 within the broader pathogenesis network

    • Machine learning applications to predict functional consequences of atpF1 variants

  • Translational research applications:

    • Development of atpF1-based subunit vaccines

    • Design of small molecule inhibitors targeting ATP synthase assembly

    • Creation of improved diagnostic tools based on atpF1 detection

  • Advanced genetic approaches:

    • CRISPR interference for temporal control of atpF1 expression

    • Site-directed mutagenesis to identify critical functional residues

    • Fluorescent protein fusions for real-time visualization during infection

Evidence gaps requiring particular attention include:

  • Direct evidence of atpF1's role in B. canis virulence remains to be established

  • Full-length B. canis atpF1 sequence and structure characterization needs completion

  • Cross-reactivity studies with other Brucella species are warranted for diagnostic development

How can researchers address the current methodological limitations in studying membrane proteins like atpF1 in Brucella species?

Emerging technologies and methodological refinements offer solutions to current challenges in studying bacterial membrane proteins like atpF1:

  • Advanced membrane protein expression systems:

    • Cell-free expression systems with defined lipid environments

    • Specialized E. coli strains optimized for membrane protein expression

    • Nanodiscs and styrene-maleic acid lipid particles (SMALPs) for native-like environments

    • Methodology: Screen multiple expression systems in parallel; optimize detergent and lipid compositions based on protein stability and activity

  • Innovative structural biology approaches:

    • Integrative structural biology combining multiple techniques (X-ray, NMR, cryo-EM)

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

    • Microcrystal electron diffraction (MicroED) for small crystals

    • Single-particle cryo-EM with improved algorithms for smaller proteins

    • Methodology: Focus on intact complexes rather than individual subunits; use computational modeling to integrate diverse structural data

  • Functional characterization innovations:

    • Solid-supported membrane electrophysiology for proton translocation

    • High-throughput liposome reconstitution systems

    • Genetically encoded sensors for ATP or membrane potential

    • Methodology: Develop specialized assays that can function in near-native membrane environments

  • In situ approaches:

    • Correlative light and electron microscopy for localization studies

    • Cryo-electron tomography of bacterial cells

    • In-cell NMR for structural insights in living bacteria

    • Methodology: Minimize disruption of native environments; develop techniques compatible with intact bacterial cells

  • Computational methods:

    • Improved membrane protein structure prediction algorithms

    • Molecular dynamics simulations in realistic membrane environments

    • Systems biology models integrating multiple data types

    • Methodology: Validate computational predictions with targeted experimental approaches

Current recombinant protein production methods have successfully generated full-length Brucella canis atpF1 with N-terminal His-tags in E. coli with high purity (>90%), providing a foundation for applying these advanced techniques .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.