Recombinant Brucella canis Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your required tag type for prioritized development.
Synonyms
mscL; BCAN_A0327; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-138
Protein Length
full length protein
Species
Brucella canis (strain ATCC 23365 / NCTC 10854)
Target Names
mscL
Target Protein Sequence
MLKEFQEFALKGNMVDLAIGVIIGGAFGGLVNSIVNDIIMPIIGLITGGIDFSNMFIQLA GDPKTTLAAAREAGATIAYGNFITLLINFLIIAWVLFLVVKLMNRLKKREEAKPAPAAPS EEVLLTEIRDILAKQQKA
Uniprot No.

Target Background

Function
A mechanosensitive channel activated by membrane stretch forces. It may regulate cellular osmotic pressure.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Brucella canis Large-conductance mechanosensitive channel (mscL) protein?

The Large-conductance mechanosensitive channel (mscL) is a membrane protein found in Brucella canis that functions as a pressure-sensitive channel, allowing the bacteria to respond to osmotic pressure changes in their environment. The protein consists of 138 amino acids and plays a critical role in bacterial survival during osmotic downshock by releasing solutes and preventing cell lysis. In recombinant form, the full-length protein is typically expressed with an N-terminal His-tag to facilitate purification and can be produced in E. coli expression systems . The protein functions as a safety valve, opening in response to membrane tension to protect bacterial cells from lysis during environmental stress conditions.

What is the amino acid sequence and structural characteristics of recombinant B. canis mscL protein?

The full-length Brucella canis mscL protein (catalog number RFL19356BF) consists of 138 amino acids with the following sequence:
MLKEFQEFALKGNMVDLAIGVIIGGAFGGLVNSIVNDIIMPIIGLITGGIDFSNMFIQLAGDPKTTLAAAREAGATIAYGNFITLLINFLIIAWVLFLVVKLMNRLKKREEAKPAPAAPSEEVLLTEIRDILAKQQKA

This protein is homologous to mechanosensitive channels in other bacterial species but has unique sequence characteristics that may contribute to B. canis-specific functions. Structurally, bacterial mscL proteins typically form homopentamers with each subunit containing two transmembrane domains connected by a periplasmic loop. The N-terminal and C-terminal domains are located in the cytoplasm, with the His-tag attached to the N-terminal end in the recombinant form.

How should recombinant B. canis mscL protein be stored and reconstituted for optimal stability?

For optimal stability and activity of recombinant B. canis mscL protein, the following handling protocols are recommended:

Storage conditions:

  • Store lyophilized protein at -20°C to -80°C upon receipt

  • Aliquot reconstituted protein to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

Reconstitution protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended)

  • Aliquot for long-term storage at -20°C/-80°C

The protein is supplied in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which helps maintain protein stability during lyophilization and reconstitution .

What experimental approaches are most effective for studying B. canis mscL function in vitro?

Several methodological approaches can be employed to investigate the functional properties of B. canis mscL protein:

Patch-clamp electrophysiology:

  • Giant spheroplast or liposome patch clamping to measure channel conductance

  • Analysis of pressure thresholds for channel opening

  • Characterization of channel kinetics and ion selectivity

Reconstitution in artificial membranes:

  • Incorporation into liposomes for functional studies

  • Fluorescent dye release assays to measure channel activity

  • Study of protein-lipid interactions that modulate channel function

Structural studies:

  • X-ray crystallography or cryo-EM to determine protein structure

  • Site-directed mutagenesis to identify functionally important residues

  • Molecular dynamics simulations to study channel gating mechanisms

When conducting these experiments, it's important to consider the membrane environment, as mechanosensitive channels are highly sensitive to membrane composition and tension. Using the recombinant His-tagged protein enables purification via affinity chromatography and subsequent reconstitution into membrane systems that mimic the native environment.

How can mouse models be utilized to investigate B. canis mscL in pathogenesis studies?

Mouse models provide valuable platforms for investigating the role of B. canis mscL in bacterial pathogenesis. Based on established B. canis infection models, researchers should consider the following methodological approach:

Mouse strain selection and infection protocol:

  • C57BL/6 mice are suitable for B. canis infection studies

  • Intraperitoneal inoculation with different doses (10^5, 10^7, or 10^9 CFU) allows for assessment of dose-dependent effects

  • Challenge dose of 1×10^7 CFU appears optimal for investigating B. canis pathogenesis and potential vaccine candidates

Experimental timeline:

  • Evaluate colonization at multiple timepoints (1, 2, 4, 6, 9, and 12 weeks post-infection)

  • B. canis persists in multiple organs, with clearance achieved by 9 weeks in the 10^5 CFU group and by 12 weeks in the 10^7 CFU group

Tissue analysis for mscL expression:

  • Collect liver, spleen, uterus, bone marrow, lung, and kidney samples

  • Use quantitative PCR to measure mscL gene expression during infection

  • Immunohistochemistry with anti-mscL antibodies to localize protein expression

Mutant strain comparisons:

  • Develop mscL-knockout B. canis strains

  • Compare colonization, persistence, and pathology between wild-type and mscL-deficient strains

  • Assess splenomegaly and granulomatous hepatitis, which are hallmark features of B. canis infection in mice at higher doses

The kinetics of B. canis infection in mice shows a slow but steady decline in colonization over time, with bacteria culturable from multiple organs, providing ample opportunity to study the role of mscL in various tissues throughout the course of infection .

What are the methodological considerations for using recombinant B. canis mscL in vaccine development?

When evaluating B. canis mscL as a potential vaccine antigen, researchers should consider several methodological approaches based on previous successful Brucella vaccine research:

Antigen formulation strategies:

  • Evaluate multiple adjuvant formulations (similar to BLSOmp31 studies)

  • Test subcutaneous immunization protocols that have shown promise with other Brucella recombinant antigens

  • Consider prime-boost strategies to enhance immune responses

Immune response assessment:

  • Measure antibody responses (IgG, IgG1, IgG2) using standardized ELISA protocols

  • Evaluate T cell responses through cytokine profiling (IFN-γ, IL-4) to determine Th1/Th2 balance

  • Previous Brucella vaccines have induced mixed Th1-Th2 responses with protective efficacy

Protection studies:

  • Challenge immunized mice with virulent B. canis (10^7 CFU appears suitable based on infection studies)

  • Evaluate bacterial burden in spleen, liver, and other organs at multiple timepoints

  • Compare protection levels to established vaccine formulations

Diagnostic interference considerations:

  • Assess whether immunization with recombinant mscL induces antibodies that interfere with serological diagnosis

  • This is crucial as non-interference with diagnostics is a desirable trait for Brucella vaccines

The recombinant chimera approach that has shown success with BLSOmp31 could serve as a model for mscL-based vaccine development, potentially combining mscL with other immunogenic Brucella antigens to enhance protective efficacy .

How might B. canis mscL contribute to bacterial survival during infection?

The mechanosensitive channel mscL likely plays several important roles in B. canis pathogenesis and survival within host environments:

Osmotic stress response:

  • Helps bacteria survive osmotic fluctuations encountered during infection

  • May be crucial during transitions between extracellular and intracellular environments

  • Could contribute to survival in various tissue microenvironments observed in mouse infection models

Intracellular survival:

  • B. canis, like other Brucella species, is an intracellular pathogen

  • mscL may help bacteria adapt to changing conditions within phagocytic cells

  • Could contribute to the persistent infection observed in mice, where bacteria remain culturable for 9-12 weeks depending on initial inoculum

Stress adaptation:

  • May function in conjunction with other stress response mechanisms

  • Could contribute to survival under immune-mediated stresses

  • May explain why B. canis can persist in multiple organs during mouse infection

Virulence regulation:

  • Channel opening/closing might regulate virulence factor expression

  • Potential contributor to the differences in virulence observed between strains (e.g., M- strain vs. wild-type)

Interestingly, the M- strain of B. canis, which is typically considered avirulent in dogs, has been documented to cause human infection with a clinical picture similar to wild-type strains . This suggests that mechanosensitive channels and other membrane components likely play complex roles in host-specific virulence that warrant further investigation.

What experimental approaches can assess the immunogenicity of B. canis mscL?

To evaluate the immunogenicity of recombinant B. canis mscL protein, researchers should consider the following experimental approaches:

Antibody response assessment:

  • Develop ELISAs using purified recombinant mscL protein

  • Measure IgG titers and subclass distribution (IgG1, IgG2) in immunized animals

  • Compare responses to those observed with other successful Brucella vaccine antigens

Cellular immunity evaluation:

Immune ParameterMethodologyExpected Outcome Based on Other Brucella Antigens
T cell proliferationIn vitro stimulation with mscLAntigen-specific proliferation in immunized animals
Cytokine productionELISPOT/flow cytometryIFN-γ and IL-4 production (mixed Th1/Th2)
CD4+/CD8+ responsesIntracellular cytokine stainingPredominant CD4+ T cell response with some CD8+ contribution

Epitope mapping:

  • Synthetic peptide arrays to identify immunodominant regions of mscL

  • Computational prediction of B and T cell epitopes

  • Correlation of epitope recognition with protective immunity

Cross-reactivity analysis:

  • Evaluate antibody recognition of native mscL in bacterial lysates

  • Assess cross-reactivity with mscL from other Brucella species

  • Determine if anti-mscL antibodies recognize the protein in different conformational states

When designing these experiments, researchers should be mindful that successful Brucella vaccine candidates typically induce strong IgG responses with balanced IgG1/IgG2 ratios and a mixed Th1-Th2 immune profile . The BLSOmp31 vaccine candidate, which has shown protection against B. canis in mice, could serve as a positive control for immunogenicity studies .

What are the challenges in expressing and purifying functional recombinant B. canis mscL?

Expression and purification of membrane proteins like B. canis mscL present several technical challenges that researchers should address with specific methodological approaches:

Expression system optimization:

  • E. coli is a suitable host for recombinant production

  • Codon optimization may improve expression levels

  • Induction conditions (temperature, IPTG concentration, duration) should be optimized to prevent inclusion body formation

Membrane protein solubilization:

  • Detergent screening is crucial (typically start with mild detergents like DDM or LDAO)

  • Detergent concentration must be optimized to maintain protein stability and function

  • Consider novel solubilization strategies such as SMALPs (styrene-maleic acid lipid particles) or nanodiscs

Purification strategy:

  • Utilize the N-terminal His-tag for initial IMAC (immobilized metal affinity chromatography)

  • Include additional purification steps (size exclusion, ion exchange) to achieve >90% purity

  • Maintain detergent above CMC (critical micelle concentration) throughout purification

Functional validation:

  • Develop assays to confirm channel functionality post-purification

  • Consider reconstitution into liposomes or nanodiscs for functional studies

  • Circular dichroism spectroscopy to confirm proper secondary structure

When working with the commercially available recombinant protein (catalog RFL19356BF), researchers should be aware that the product is supplied as a lyophilized powder with >90% purity as determined by SDS-PAGE . Reconstitution protocols must be carefully followed to maintain protein integrity and functionality.

How can protein interaction studies be designed to identify binding partners of B. canis mscL?

To identify proteins that interact with B. canis mscL and potentially regulate its function, several complementary approaches can be employed:

Pull-down assays utilizing His-tagged mscL:

  • Immobilize recombinant His-tagged mscL on Ni-NTA resin

  • Incubate with B. canis lysates under varying conditions

  • Elute and identify binding partners using mass spectrometry

  • Confirm interactions using reciprocal co-immunoprecipitation

Bacterial two-hybrid systems:

  • Adapt standard bacterial two-hybrid approaches for membrane protein analysis

  • Screen B. canis genomic libraries for potential interactors

  • Validate positive hits with secondary binding assays

Crosslinking approaches:

  • Use chemical crosslinkers of varying lengths to capture transient interactions

  • Perform in vivo crosslinking in bacteria expressing tagged mscL

  • Identify crosslinked partners using mass spectrometry

Proximity labeling techniques:

  • Fuse mscL to enzymes like BioID or APEX2

  • Allow proximity-dependent labeling of nearby proteins in living bacteria

  • Identify labeled proteins by streptavidin pull-down and mass spectrometry

Fluorescence-based interaction assays:

  • FRET (Förster Resonance Energy Transfer) between labeled mscL and candidate partners

  • Bimolecular fluorescence complementation (BiFC) to visualize interactions in bacterial cells

  • Single-molecule tracking to observe protein-protein interactions in membranes

When designing these experiments, it's important to consider the membrane environment of mscL and to include appropriate controls for non-specific binding. The recombinant protein's His-tag provides a convenient handle for pull-down experiments, but researchers should be mindful that the tag itself might influence certain interactions .

How does B. canis mscL compare to mechanosensitive channels in other bacterial species?

Comparative analysis of B. canis mscL with homologous proteins from other bacterial species provides important insights into functional conservation and species-specific adaptations:

Sequence comparison with model bacterial mscL proteins:

  • B. canis mscL (138 amino acids) shares structural features with well-characterized mscL proteins

  • Compare with E. coli mscL (136 amino acids) and M. tuberculosis mscL (151 amino acids)

  • Key transmembrane domains and gating regions are generally conserved across species

Functional differences:

  • B. canis mscL may be adapted to the intracellular lifestyle of this pathogen

  • Gating tension thresholds might differ from other bacterial species

  • May have unique interactions with Brucella-specific membrane components

Evolutionary considerations:

  • mscL is highly conserved across bacterial species, suggesting essential function

  • Species-specific variations may reflect adaptation to different environmental niches

  • Comparison with mscL from other Brucella species (B. melitensis, B. abortus) may reveal virulence-associated adaptations

Understanding these comparative aspects is particularly relevant when considering that B. canis can establish persistent infections in multiple host organs, as demonstrated in mouse models . The ability to persist in diverse tissue environments may be partially mediated by the adaptive functions of mechanosensitive channels like mscL.

What role might B. canis mscL play in zoonotic transmission and human infection?

Research on the M- strain of B. canis has shown that this strain, while considered avirulent in dogs, can cause human infection with symptoms similar to wild-type B. canis infection . This finding has important implications for understanding the role of membrane proteins like mscL in host adaptation and zoonotic potential:

Host adaptation considerations:

  • mscL may function differently in different host environments

  • Changes in osmotic conditions between canine and human hosts may influence mscL activity

  • The protein may contribute to bacterial survival during host transition

Implications for laboratory research:

  • Laboratory workers handling B. canis cultures, including supposedly attenuated strains, should take appropriate precautions

  • Documented human infection with M- strain underscores the zoonotic potential of B. canis

  • Research on recombinant mscL requires standard biosafety measures despite working with just the isolated protein

Translational research opportunities:

  • mscL could represent a target for developing broad-spectrum therapeutics against Brucella

  • Inhibitors of mscL function might reduce bacterial survival during infection

  • Understanding species-specific features of mscL could help explain host tropism

The case report documenting human infection with the M- strain of B. canis indicates that even attenuated strains can cause clinical disease in humans with symptoms and immune responses similar to those observed with wild-type infections . This suggests that membrane components and their functions are critical determinants of cross-species infectivity and pathogenesis.

What novel research applications could leverage recombinant B. canis mscL protein?

The availability of recombinant B. canis mscL protein opens several innovative research avenues:

Structural biology applications:

  • Cryo-EM studies to determine the structure of B. canis mscL in different conformational states

  • Investigation of lipid-protein interactions that modulate channel function

  • Structure-guided design of specific inhibitors

Nanobiotechnology applications:

  • Development of biosensors based on mscL mechanosensitivity

  • Creation of stimulus-responsive drug delivery systems

  • Engineering of synthetic cells with controllable osmotic properties

Immunological research:

  • Development of mscL-based diagnostic tools for B. canis infection

  • Investigation of mscL as part of multi-antigen vaccine formulations

  • Study of structure-function relationships in immune recognition of bacterial antigens

Drug discovery platforms:

  • High-throughput screening for compounds that modulate mscL function

  • Identification of inhibitors that could reduce bacterial survival during infection

  • Development of combination therapies targeting multiple bacterial stress response systems

The recombinant protein's high purity (>90%) makes it suitable for these advanced applications, providing researchers with a reliable reagent for pushing the boundaries of Brucella research.

How might systems biology approaches enhance our understanding of B. canis mscL function?

Systems biology approaches can provide comprehensive insights into the role of mscL within the broader context of B. canis biology:

Integrative omics analysis:

  • Combine transcriptomics, proteomics, and metabolomics data to identify networks involving mscL

  • Compare wild-type and mscL-deficient strains under various stress conditions

  • Identify condition-specific co-expression patterns that suggest functional relationships

Computational modeling:

  • Develop mathematical models of bacterial osmotic stress responses incorporating mscL function

  • Simulate channel behavior under different environmental conditions

  • Predict consequences of mscL inhibition on bacterial survival

Network analysis:

  • Map protein-protein interaction networks centered on mscL

  • Identify signaling pathways that regulate or are regulated by mscL activity

  • Discover potential compensatory mechanisms when mscL function is compromised

These approaches are particularly relevant given that B. canis infection in mice shows distinct patterns of tissue colonization and persistence, with bacteria detectable in multiple organs over several weeks . Systems-level analysis could help explain how mechanosensitive channels contribute to this persistent infection phenotype.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.