Recombinant Brucella canis Lectin-like protein BA14k (BCAN_B0743)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes. We will fulfill requests as possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If a particular tag type is required, please inform us; we will prioritize its use in the production process.
Synonyms
BCAN_B0743; Lectin-like protein BA14k
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
27-147
Protein Length
Full Length of Mature Protein
Species
Brucella canis (strain ATCC 23365 / NCTC 10854)
Target Names
BCAN_B0743
Target Protein Sequence
APMNMDRPAINQNVIQARAHYRPQNYNRGHRPGYWHGHRGYRHYRHGYRRHNDGWWYPLA AFGAGAIIGGAISQPRPVYRAPAGSPHVQWCYSRYKSYRASDNTFQPYNGPRKQCRSPYS R
Uniprot No.

Target Background

Function

This lectin-like protein exhibits immunoglobulin-binding and hemagglutination properties and binds to mannose. It is crucial for virulence and may be involved in LPS biosynthesis or polysaccharide transport.

Database Links
Protein Families
BA14k family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is Brucella canis Lectin-like protein BA14k (BCAN_B0743)?

Brucella canis Lectin-like protein BA14k is a protein encoded by the BCAN_B0743 gene in Brucella canis bacteria. This protein is classified as a lectin-like protein with a UniProt ID of A9MC22. The mature protein spans amino acids 27-147, with a full sequence length of 121 amino acids . The protein is significant in both veterinary and human medicine as Brucella canis is pathogenic for both dogs and humans .

How should recombinant BA14k be stored and handled for optimal stability?

Proper storage and handling of recombinant BA14k protein is critical for maintaining its structural integrity and biological activity. The following protocols are recommended:

ParameterRecommendation
Storage Temperature-20°C/-80°C upon receipt
Physical FormLyophilized powder
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL
Long-term StorageAdd 5-50% glycerol (final concentration) and aliquot
AliquotingNecessary for multiple use
Freeze-thawAvoid repeated cycles
Working AliquotsStore at 4°C for up to one week

Repeated freezing and thawing is not recommended as it can lead to protein degradation and loss of activity . For optimal results, the vial should be briefly centrifuged prior to opening to bring the contents to the bottom.

What factors influence successful expression of recombinant BA14k in E. coli systems?

The successful expression of recombinant Brucella canis Lectin-like protein BA14k in E. coli depends significantly on mRNA accessibility at translation initiation sites. Analysis of large-scale recombinant protein production experiments (N = 11,430) has revealed that:

  • mRNA accessibility is the single best predictor of protein expression across diverse datasets .

  • The accessibility of translation initiation sites (specifically the region -24:24) outperforms other mRNA features with an AUC score of 0.70 .

  • Sequences with high accessibility (low opening energy) are approximately two times more likely to be successfully expressed than those with poor accessibility .

This suggests that optimizing the mRNA sequence for better accessibility at the translation initiation site could significantly improve the expression of BA14k protein in E. coli systems.

How can synonymous codon changes improve BA14k expression yields?

The expression yield of recombinant proteins, including BA14k, can be tuned through synonymous codon changes, particularly at translation initiation sites. Research across 11,430 recombinant protein production experiments demonstrates that:

Researchers can use computational tools to predict optimal synonymous codon substitutions that maximize mRNA accessibility while maintaining the desired protein sequence.

Why is cross-reactivity a major challenge in serological diagnosis using B. canis proteins?

Serological diagnosis using Brucella canis proteins faces significant challenges due to cross-reactivity with other bacteria, leading to false positive reactions. This issue arises from:

  • Antigenic similarities between Brucella species and other gram-negative bacteria.

  • The presence of conserved epitopes across multiple bacterial species that can be recognized by antibodies.

  • Current whole-antigen tests lacking the specificity needed to distinguish between true infections and cross-reactive antibodies .

These challenges highlight the importance of identifying specific B. canis proteins or epitopes that can improve diagnostic specificity. Proteomics and bioinformatics approaches have identified 16 non-cytoplasmic immunogenic proteins predicted as non-homologous with the most important Brucella cross-reactive bacteria, which may serve as better candidates for diagnostic test development .

How can western blotting be optimized for detection of B. canis infection?

Western blotting has been successfully developed to define serum antibody patterns associated with B. canis infection. Optimization includes:

  • Using positive and negative dog sera panels for validation.

  • Focusing on immunogenic bands ranging from 7 to 30 kDa, which have been identified as specific for B. canis infection .

  • Employing ESI-LC-MS/MS for protein identification in these bands.

  • Analyzing results with bioinformatics tools to identify specific immunogenic proteins.

The optimized western blotting test has demonstrated the ability to distinguish between infected and non-infected animals and may serve as a confirmatory test for the serological diagnosis of B. canis .

What protein identification techniques are most effective for characterizing BA14k and related proteins?

For effective characterization of BA14k and related proteins, a combination of proteomics techniques has proven most effective:

  • ESI-LC-MS/MS (Electrospray Ionization-Liquid Chromatography-Tandem Mass Spectrometry):

    • Provides high-resolution protein identification

    • Allows for analysis of complex protein mixtures

    • Successfully identified 398 B. canis proteins in recent studies

  • Bioinformatics Analysis Pipeline:

    • Sequence homology searches against Brucella and related bacterial databases

    • Prediction of subcellular localization to identify non-cytoplasmic proteins

    • Comparison with cross-reactive bacteria to identify non-homologous proteins

  • Western Blotting Coupled with MS:

    • Identification of immunogenic bands (7-30 kDa range)

    • Direct correlation between antibody recognition and protein identity

    • Validation with positive and negative control sera

These combined approaches have successfully led to the identification of specific B. canis proteins that could serve as candidate antigens for improved diagnostic tests .

What bioinformatic approaches are most valuable for predicting immunogenic epitopes in BA14k?

Bioinformatic approaches for predicting immunogenic epitopes in BA14k and other B. canis proteins involve several complementary methods:

  • Sequence-Based Homology Analysis:

    • Comparison with known immunogenic proteins from other Brucella species

    • Identification of unique sequences in BA14k not present in cross-reactive bacteria

    • Identification of 9 B. canis proteins non-homologous to B. ovis, with one also non-homologous to B. melitensis

  • Structural Prediction and Epitope Mapping:

    • Prediction of exposed regions likely to be recognized by antibodies

    • Analysis of protein secondary and tertiary structure

    • Identification of conserved versus variable regions

  • Subcellular Localization Prediction:

    • Identification of surface-exposed or secreted proteins

    • Focus on 16 non-cytoplasmic immunogenic proteins predicted to have minimal cross-reactivity

    • Prediction of signal peptides and transmembrane domains

These approaches collectively provide a comprehensive strategy for identifying specific epitopes that could improve the specificity and sensitivity of diagnostic tests for B. canis infection.

How can mRNA accessibility be experimentally measured for BA14k expression optimization?

Experimental measurement of mRNA accessibility for BA14k expression optimization can be approached through several methods:

  • Reporter Gene Assays:

    • Fusion of BA14k translation initiation regions with reporter genes (GFP, luciferase)

    • Quantification of expression levels as a proxy for accessibility

    • Systematic testing of synonymous codon variants at positions -24 to +24 relative to the start codon

  • Structure Probing Techniques:

    • SHAPE (Selective 2′-hydroxyl acylation analyzed by primer extension)

    • DMS (Dimethyl sulfate) probing

    • In-line probing to directly assess RNA structure around the translation initiation site

  • Computational-Experimental Integration:

    • Prediction of opening energies using computational models

    • Validation with expression data from variant constructs

    • Correlation analysis between predicted accessibility and measured protein yields

Research has shown that the accessibility of the region from -24 to +24 is particularly important, with opening energy in this region being the best predictor of expression success with an AUC score of 0.70 .

What statistical approaches are recommended for analyzing BA14k expression data?

When analyzing expression data for recombinant BA14k protein, several statistical approaches are recommended:

  • Measures of Central Tendency and Variability:

    • Use of mean, median, and mode to describe expression levels

    • Assessment of variability through range, variance, and standard deviation

    • Control of variability through standardized experimental procedures

  • Inferential Statistics:

    • Hypothesis testing to determine significance of expression changes

    • Application of parametric or non-parametric tests based on data distribution

    • Control for Type I and Type II errors in statistical analysis

  • Correlation and Regression Analysis:

    • Spearman's correlation (Rs) to assess relationships between mRNA features and expression levels

    • Logistic regression to develop predictive models of expression outcomes

    • Random forest analysis to rank the importance of different features

  • Multifactorial Analysis:

    • ANOVA for experiments with multiple variables

    • Assessment of interaction effects between experimental factors

    • Meta-analysis when combining data from multiple experiments

What are the most promising future research directions for BA14k applications?

The most promising future research directions for BA14k applications include:

  • Improved Diagnostic Tests:

    • Development of serological tests using BA14k as a specific antigen

    • Reduction of cross-reactivity through epitope selection and optimization

    • Integration into multiplexed assays for comprehensive Brucella diagnosis

  • Expression Optimization:

    • Application of translation initiation site optimization techniques

    • Development of customized expression systems for maximum yield

    • Exploration of alternative host systems beyond E. coli

  • Structural and Functional Characterization:

    • Determination of three-dimensional structure

    • Investigation of lectin-like binding properties and specificity

    • Exploration of potential roles in pathogenesis and host-pathogen interactions

These research directions could significantly advance both the understanding of BA14k biology and its practical applications in diagnosis and research.

How can contradictory expression data for BA14k be reconciled through experimental design?

Reconciling contradictory expression data for BA14k requires careful experimental design considerations:

  • Standardization of Expression Systems:

    • Use of consistent promoters, ribosome binding sites, and vector backbones

    • Control of induction conditions and growth parameters

    • Documentation of all experimental variables

  • Comprehensive Feature Analysis:

    • Assessment of multiple features including mRNA accessibility, codon usage, and G+C content

    • Evaluation of their relative importance in different experimental contexts

    • Integration of findings through statistical models

  • Systematic Variation Testing:

    • Creation of variant libraries with controlled changes

    • Isolation of specific variables through factorial design

    • Application of meta-analysis techniques to aggregate findings across studies

  • Validation Across Multiple Scales:

    • Testing from small-scale expression to large-scale production

    • Verification of findings across different laboratories

    • Correlation of in silico predictions with experimental outcomes

By implementing these approaches, researchers can better understand the factors affecting BA14k expression and resolve apparent contradictions in experimental results.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.