Recombinant Brucella canis NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Functional Residues

While specific mutational studies on Brucella canis nuoK are absent, conserved residues in homologous proteins (e.g., Mycobacterium bovis nuoK , E. coli NDH-1 ) highlight critical regions:

  • Glu-36 (TM2): Essential for proton translocation; mutation to Ala abolishes NDH-1 activity .

  • Glu-72 (TM3): Modulates activity; substitutions reduce proton pumping efficiency .

  • Cytoplasmic Loop (Arg-25, Arg-26, Asn-27): Vital for energy coupling .

Bioenergetic Contributions

The NDH-1 complex, including nuoK, catalyzes electron transfer from NADH to quinone while pumping protons across the membrane. In Brucella, this process is likely critical for intracellular survival in host cells, where ATP production and redox balance are essential.

Pathogenic Relevance

While nuoK itself is not directly targeted in current diagnostic assays for B. canis (unlike Omp25 or PdhB/Tuf ), its role in maintaining membrane potential and ATP synthesis positions it as a potential therapeutic target.

Expression and Purification Workflow

Recombinant nuoK is typically produced via:

  1. Cloning: Insertion of the nuoK gene into a plasmid vector (e.g., pET series).

  2. Expression: Induction in E. coli with IPTG, followed by cell lysis.

  3. Purification: Affinity chromatography via His-tag, followed by size-exclusion or ion-exchange chromatography.

ParameterOptimal Condition
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL)
Glycerol Addition5–50% (50% default for long-term storage)
Storage-20°C/-80°C; avoid freeze-thaw cycles

Source: Chemicalbook production guidelines

Diagnostic Potential

While nuoK is not currently used in serological assays (e.g., ELISA for B. canis targets PdhB or Tuf ), its conserved residues could be explored as epitopes for vaccine development.

Research Gaps

  • Functional Characterization: Direct studies on B. canis nuoK’s role in pathogenesis are lacking.

  • Antigenicity: No data exist on nuoK’s immunogenicity in canine or human sera.

Opportunities

  • Therapeutic Targets: Inhibitors targeting nuoK’s proton-translocation residues could disrupt B. canis bioenergetics.

  • Structural Analysis: Cryo-EM or X-ray crystallography of B. canis NDH-1 could elucidate species-specific interactions.

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we understand your specific needs. Should you require a particular format, please indicate your preference in your order notes, and we will fulfill your request whenever possible.
Lead Time
Delivery time may vary based on the purchasing method and location. Kindly consult your local distributor for precise delivery time estimates.
Note: Our standard shipping method includes normal blue ice packs. For shipments with dry ice, please contact us in advance to arrange for the additional service and associated charges.
Notes
Repeated freezing and thawing of the product is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend a brief centrifugation of the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a guideline for your own preparations.
Shelf Life
The shelf life of this product is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store the product at -20°C/-80°C. For multiple use, aliquotting is recommended. To maintain optimal product integrity, avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please communicate it to us, and we will prioritize developing the specified tag if feasible.
Synonyms
nuoK; BCAN_A0827; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Brucella canis (strain ATCC 23365 / NCTC 10854)
Target Names
nuoK
Target Protein Sequence
MEIGIAHYLTVSAILFTLGVFGIFLNRKNVIVILMSIELILLSVNLNFVAFSSQLGDLVG QVFALFVLTVAAAEAAIGLAILVVFFRNRGSIAVEDVNVMKG
Uniprot No.

Target Background

Function
NDH-1 facilitates the transfer of electrons from NADH, through FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this particular species, the primary electron acceptor for the enzyme is believed to be ubiquinone. This enzymatic process couples the redox reaction with proton translocation, where for every two electrons transferred, four hydrogen ions are moved across the cytoplasmic membrane. This mechanism conserves the redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.