Recombinant Brucella canis Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant htpX is synthesized via bacterial expression systems. Critical steps include:

  • Cloning: The htpX gene is cloned into a plasmid vector for expression in E. coli.

  • Expression: Induced under optimized conditions to maximize yield.

  • Purification: Affinity chromatography (via His tag) followed by lyophilization.

Key Notes:

  • Repeated freeze-thaw cycles are discouraged to preserve stability .

  • Storage recommendations: -20°C/-80°C for long-term stability, with working aliquots stored at 4°C for ≤1 week .

Research Applications and Diagnostic Potential

While htpX is primarily used in research, its role in Brucella canis pathogenesis remains understudied. Emerging applications include:

Comparative Analysis with Other Recombinant Proteins

Below is a comparison of htpX with other Brucella canis recombinant proteins used in diagnostics:

ProteinFunction/RoleDiagnostic UtilitySources
htpXPutative proteaseLimited; primarily research use
PdhBPyruvate dehydrogenase subunitHigh sensitivity in human sera
TufElongation factor TuSpecific to human infections
VirB ProteinsType IV secretion systemHigh diagnostic accuracy

Challenges and Future Directions

  • Functional Elucidation: No direct evidence links htpX to Brucella canis virulence or host-pathogen interaction.

  • Diagnostic Optimization: Further validation is needed to assess htpX’s utility in serological assays, particularly in canine samples .

  • Genomic Context: Whole-genome sequencing of B. canis isolates has identified polymorphisms in omp25 and virB genes, but htpX remains uncharacterized in such studies .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
htpX; BCAN_A1851; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-325
Protein Length
full length protein
Species
Brucella canis (strain ATCC 23365 / NCTC 10854)
Target Names
htpX
Target Protein Sequence
MNMTKTAMLIALMTVMFMSIGYLLGGGGGMMIALVIAVAMNLFGYWNSDKMVLRMYNAQE VDERSAPEYYRMVSGLAANAGLPMPKVYIIHEDQPNAFATGRNPENAAVAATTGLLNRLS PEEVAGVMAHELAHVQNRDTLTMTIVATLAGAISMLGNFAFFLGGNRENGNGVMGVVGTL LAMIVAPFAAMIVQMAVSRTREYAADKRGAEICGNPLWLSSALGKIARGAKVIPNEEAEH NPATAHMFIINPLSGRGADNLFSTHPDTDNRIAALEQMAAEMGIRSAAMTARAAAPSQNS GPWGQRSDNAGGNSNGGSRYRGPWS
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Brucella canis Protease HtpX homolog and what is its biological function?

Protease HtpX homolog (htpX) is a membrane-bound zinc metalloprotease found in Brucella species including B. canis. It belongs to a class of proteases involved in protein quality control and stress response pathways. The protein functions primarily in the degradation of misfolded membrane proteins, playing a critical role in bacterial survival under stress conditions. Similar to other bacterial HtpX proteases, it likely participates in proteolytic pathways that maintain cellular homeostasis, particularly during environmental stress or host infection processes . In Brucella species, membrane proteases like HtpX may contribute to virulence by helping the bacterium adapt to the harsh intracellular environment of macrophages.

What is the molecular structure and important domains of HtpX in Brucella canis?

The full-length HtpX protease from Brucella species typically consists of approximately 325 amino acids, as observed in the homologous protein from B. abortus . The protein contains multiple transmembrane domains that anchor it to the bacterial membrane. Key functional regions include:

  • A zinc-binding motif (HEXXH) in the catalytic domain, essential for metalloprotease activity

  • Transmembrane segments that integrate the protein into the bacterial membrane

  • Cytoplasmic domains involved in substrate recognition

The protein's membrane topology is important for its function, as it must recognize and cleave misfolded membrane proteins. While the specific crystal structure of B. canis HtpX has not been fully resolved, homology modeling based on related bacterial proteases suggests a conserved fold typical of zinc metalloproteases in the M48 family .

What are the optimal conditions for heterologous expression of recombinant B. canis HtpX?

For efficient heterologous expression of recombinant B. canis HtpX, the following methodological considerations are recommended:

Expression System Selection:

  • E. coli is the most commonly used expression system, with BL21(DE3) strain being particularly effective for recombinant Brucella proteins .

  • For membrane proteins like HtpX, E. coli strains optimized for membrane protein expression (C41/C43) may yield better results.

Expression Constructs:

  • Fusion tags such as His6x at either N- or C-terminus facilitate purification while maintaining protein activity .

  • Codon optimization for E. coli expression is advisable due to codon usage differences between Brucella and E. coli.

Induction Conditions:

  • IPTG concentration: 0.5-1.0 mM

  • Temperature: Lower temperatures (16-25°C) often improve folding of membrane proteins

  • Induction duration: Extended induction periods (16-20 hours) at lower temperatures may improve yield

Buffer Composition:

  • Inclusion of glycerol (5-10%) helps stabilize membrane proteins

  • Buffer pH 7.5-8.0 typically provides optimal stability for Brucella proteases

What purification strategies are most effective for recombinant B. canis HtpX?

Purification of recombinant HtpX requires careful consideration of its membrane-associated nature. The following stepwise purification protocol is recommended:

  • Membrane Fraction Isolation:

    • Cell lysis using sonication or French press in buffer containing protease inhibitors

    • Separation of membrane fraction by ultracentrifugation (100,000 × g, 1 hour)

  • Solubilization:

    • Use of mild detergents (DDM, LDAO, or Triton X-100) at concentrations above their critical micelle concentration

    • Incubation at 4°C with gentle agitation for 1-2 hours

  • Affinity Chromatography:

    • If His-tagged, use Ni-NTA resin for initial capture

    • Wash with buffer containing reduced detergent concentration and low imidazole (10-20 mM)

    • Elution with imidazole gradient (50-300 mM)

  • Further Purification:

    • Size exclusion chromatography to remove aggregates and achieve higher purity

    • Ion exchange chromatography as a polishing step

  • Buffer Exchange and Storage:

    • Final buffer containing 50 mM Tris-HCl pH 8.0, 150 mM NaCl, detergent below CMC, 6% trehalose

    • Storage at -80°C in small aliquots to prevent freeze-thaw cycles

This protocol typically yields >90% pure protein suitable for both enzymatic and structural studies .

How can the proteolytic activity of recombinant B. canis HtpX be measured?

The proteolytic activity of recombinant B. canis HtpX can be assessed through several complementary approaches:

Fluorogenic Peptide Substrates:

  • Synthetic peptides with fluorogenic groups (e.g., 7-amido-4-methylcoumarin) that release a fluorescent signal upon cleavage

  • Reaction conditions: 50 mM HEPES pH 7.5, 100 mM NaCl, 5 mM MgCl₂, 1 mM DTT, 37°C

  • Continuous monitoring of fluorescence increase (excitation/emission wavelengths dependent on fluorophore)

Gel-Based Assays:

  • Incubation of HtpX with candidate protein substrates followed by SDS-PAGE analysis

  • Cleavage products visualized by Coomassie staining or western blotting

  • Time-course experiments to determine reaction kinetics

HPLC/Mass Spectrometry:

  • Identification of cleavage sites by analyzing peptide fragments

  • LC-MS/MS analysis of digestion products to map the exact peptide bond cleaved by HtpX

  • Determination of substrate specificity through analysis of multiple substrates

Controls: Include zinc chelators (EDTA, 1,10-phenanthroline) as negative controls, as they should inhibit metalloprotease activity of HtpX.

What are the known substrates of B. canis HtpX and how does substrate specificity compare to other Brucella proteases?

While specific substrates for B. canis HtpX have not been comprehensively characterized, research on homologous proteases suggests:

Potential Substrates:

  • Misfolded membrane proteins, particularly during stress conditions

  • Regulatory proteins involved in virulence expression

  • Outer membrane proteins that may be processed during infection

Substrate Specificity Comparison:

ProteaseSubstrate PreferenceCleavage MotifCellular LocationRole in Virulence
HtpXMisfolded membrane proteinsHydrophobic residuesMembrane-boundStress response
CtpAProteins destined for cell envelopeC-terminal processingCell envelopeEssential for morphology and intracellular survival
DegP/HtrAMisfolded periplasmic proteinsVariablePeriplasmicStress tolerance

The CtpA carboxyl-terminal protease in B. suis, unlike HtpX, has been directly linked to bacterial morphology and is essential for intracellular survival within macrophages and virulence in mouse models . Understanding the substrate overlap and functional differentiation between these proteases is critical for comprehending the protease network in Brucella pathogenesis.

How can recombinant B. canis HtpX be utilized for brucellosis diagnostic development?

Recombinant B. canis HtpX presents significant potential for diagnostic applications, particularly in serological tests:

Indirect ELISA Development:

  • Recombinant HtpX can serve as a capture antigen in indirect ELISA systems

  • Protocol adaptation would follow established methodology for recombinant Brucella proteins:

    • Coating microplates with purified HtpX (1-5 μg/ml in carbonate buffer pH 9.6)

    • Blocking with 5% skim milk or BSA

    • Incubation with diluted serum samples

    • Detection with species-specific conjugated secondary antibodies

    • Colorimetric substrate development and absorbance measurement

Evaluation Parameters:

  • Sensitivity and specificity determination using well-characterized positive and negative serum panels

  • Cross-reactivity assessment with sera from animals infected with other pathogens

  • Comparison with established tests (RSAT, 2ME-RSAT, agar gel immunodiffusion)

This approach parallels methods used for other recombinant Brucella proteins like PdhB and Tuf, which demonstrated utility for detection of B. canis antibodies in human sera . Similar approaches could be employed for developing B. canis HtpX-based diagnostics, particularly if this protein demonstrates immunogenicity and specificity.

What advantages might HtpX offer as a diagnostic antigen compared to currently used Brucella antigens?

Recombinant B. canis HtpX may present several advantages as a diagnostic antigen:

Specificity Enhancement:

  • Bioinformatic analyses have identified several B. canis proteins with minimal homology to proteins from cross-reactive bacteria

  • If HtpX contains species-specific epitopes, it could reduce false-positive reactions common with whole-cell antigens

  • Proteomics studies have identified 398 B. canis proteins, with 16 non-cytoplasmic immunogenic proteins predicted as non-homologous with the most important cross-reactive bacteria

Standardization Benefits:

  • Recombinant production ensures batch-to-batch consistency compared to whole-cell extracts

  • Defined protein composition eliminates variability associated with bacterial culture conditions

  • Quantifiable antigen concentrations enable precise assay standardization

Technical Advantages:

  • Potential for multiplexing with other recombinant Brucella antigens

  • Compatibility with various assay formats (ELISA, lateral flow, protein microarrays)

  • Possibility of epitope mapping to further enhance specificity

While specific data for HtpX is limited, research with other recombinant Brucella antigens demonstrates the potential value of this approach. For example, PdhB and Tuf proteins have shown utility in detecting B. canis infection in humans, though they were less effective for canine diagnosis . Comparative studies would be necessary to determine if HtpX offers superior diagnostic performance.

What role might HtpX play in Brucella canis virulence and intracellular survival?

The potential role of HtpX in B. canis virulence can be examined through several lines of evidence and hypotheses:

Stress Response Mechanism:

  • As a membrane protease involved in protein quality control, HtpX likely contributes to bacterial adaptation to stressful environments encountered during infection

  • Similar to other Brucella proteases like CtpA, HtpX may be essential for maintaining cellular integrity under stress conditions encountered within macrophages

Possible Virulence Mechanisms:

  • Membrane Homeostasis: Maintaining membrane protein quality during phagosomal trafficking

  • Stress Adaptation: Degradation of misfolded proteins during oxidative stress or nutrient limitation

  • Virulence Factor Processing: Potential role in maturation or activation of other virulence determinants

  • Host-Pathogen Interaction: Possible modification of bacterial surface proteins that interact with host receptors

Experimental Evidence from Related Systems:
Studies with the CtpA protease in B. suis demonstrated that protease-deficient mutants exhibited altered cell morphology, reduced growth rates, and significantly decreased survival in macrophages and mice . Similar investigation of HtpX through mutant analysis would help elucidate its specific role in virulence.

How can structural biology approaches enhance our understanding of HtpX function and inform inhibitor design?

Advanced structural biology approaches can provide critical insights into HtpX function:

Structural Determination Strategies:

  • X-ray Crystallography: Challenging for membrane proteins but possible with protein engineering to improve crystallization properties

  • Cryo-Electron Microscopy: Increasingly powerful for membrane protein structure determination

  • NMR Spectroscopy: Useful for determining dynamic regions and substrate binding interactions

Structure-Function Applications:

  • Catalytic Mechanism: Identification of active site residues and metal coordination geometry

  • Substrate Recognition: Mapping the substrate-binding pocket and specificity determinants

  • Inhibitor Design: Structure-based design of specific inhibitors as potential antimicrobials

  • Comparative Analysis: Structural comparison with host proteases to inform selective inhibition

Inhibitor Development Pathway:

  • Virtual screening against the active site to identify lead compounds

  • Structure-activity relationship studies to optimize potency and selectivity

  • In vitro validation using enzymatic assays with recombinant HtpX

  • Cellular studies to evaluate inhibitor penetration and target engagement

  • In vivo efficacy evaluation in animal models of brucellosis

These approaches could eventually lead to novel therapeutic strategies targeting Brucella proteases, potentially circumventing issues of antibiotic resistance.

What cell-based systems are most appropriate for studying B. canis HtpX function in a host-pathogen context?

Several experimental systems can be employed to study B. canis HtpX in host-pathogen interactions:

Macrophage Infection Models:

  • J774 Mouse Macrophage Cell Line: Widely used for Brucella infection studies and documented in research with other Brucella proteases like CtpA

  • RAW 264.7 Cells: Useful for studying bacterial survival and replication

  • Primary Macrophages: More physiologically relevant but with higher variability

  • THP-1 Human Monocytes: Can be differentiated into macrophage-like cells

Experimental Design Considerations:

  • Genetic Manipulation: Creation of HtpX knockout or conditional mutants in B. canis

  • Complementation: Re-introduction of wild-type or mutant HtpX to confirm phenotypes

  • Infection Protocol:

    • MOI optimization (typically 50-100 bacteria per cell)

    • Extracellular bacteria removal with gentamicin treatment

    • Time-course analysis (1-72 hours post-infection)

  • Readouts:

    • Intracellular bacterial survival (CFU determination)

    • Subcellular localization (fluorescence microscopy)

    • Host cell responses (cytokine production, cell death)

Animal Models:

  • BALB/c mice represent a well-established model for brucellosis

  • Experimental parameters include: bacterial load in spleen and liver, histopathological changes, antibody responses, and cytokine profiles

These systems would allow for comprehensive functional characterization of HtpX in the context of B. canis pathogenesis, similar to studies performed with CtpA in B. suis .

What are the key methodological challenges in expressing and working with membrane proteases like HtpX?

Working with membrane proteases like HtpX presents several technical challenges that require specific methodological considerations:

Expression Challenges:

  • Toxicity: Overexpression of active proteases can be toxic to host cells

    • Solution: Use inducible systems with tight regulation or inactive mutants

  • Inclusion Body Formation: Tendency to aggregate when overexpressed

    • Solution: Lower expression temperature, use solubility-enhancing fusion partners

Purification Challenges:

  • Detergent Selection: Critical for extracting membrane proteins while maintaining activity

    • Systematic screening of detergents (DDM, LDAO, CHAPS) at various concentrations

  • Protein Stability: Membrane proteins often destabilize outside their native environment

    • Addition of stabilizers like glycerol (5-10%) and trehalose (6%)

Activity Assay Challenges:

  • Detergent Interference: Detergents may affect enzyme kinetics or substrate accessibility

    • Control experiments with varying detergent concentrations

  • Substrate Accessibility: Natural substrates may be membrane-embedded

    • Development of model substrate systems mimicking membrane environment

Structural Analysis Challenges:

  • Crystallization Difficulties: Membrane proteins are notoriously difficult to crystallize

    • Lipidic cubic phase crystallization methods

    • Detergent screening for optimal crystal formation

  • Conformational Heterogeneity: Functional flexibility can impede structural determination

    • Protein engineering to stabilize specific conformations

These methodological considerations are essential for successful experimental work with B. canis HtpX and similar membrane proteases.

How conserved is HtpX across Brucella species and what does this suggest about its functional importance?

The conservation pattern of HtpX across Brucella species provides insights into its evolutionary and functional significance:

Sequence Conservation Analysis:
HtpX is highly conserved across Brucella species, with:

  • B. abortus HtpX serving as a model for homologous proteins in other species

  • Typical sequence identity >90% among classical Brucella species (B. abortus, B. melitensis, B. suis, B. canis)

  • The zinc-binding motif and catalytic domains showing particularly high conservation

  • Transmembrane topology being preserved across species

Evolutionary Implications:

  • High conservation suggests strong selective pressure to maintain HtpX function

  • Essential cellular roles typically correlate with higher sequence conservation

  • The maintenance of HtpX across diverse Brucella species that infect different hosts (cattle, sheep, swine, dogs) indicates a core function in the bacterial life cycle rather than host-specific adaptation

Functional Predictions Based on Conservation:

  • Highly conserved regions likely represent essential functional domains

  • Variable regions may indicate species-specific adaptations or functionally flexible regions

  • Comparison with non-pathogenic alphaproteobacteria could highlight regions specifically important for pathogenesis

This conservation pattern suggests HtpX plays a fundamental role in Brucella biology, likely related to essential cellular processes such as protein quality control and stress response rather than host-specific virulence functions.

How does B. canis HtpX differ from homologous proteases in other bacterial pathogens?

Understanding the differences between B. canis HtpX and homologous proteases in other bacterial pathogens provides valuable insights into Brucella-specific functions:

Comparative Features with Other Bacterial HtpX Homologs:

FeatureB. canis HtpXE. coli HtpXMycobacterial HtpXOther Alphaproteobacteria
Size~325 amino acids~290 amino acids~330 amino acids300-330 amino acids
Zn-binding motifHEXXHHEXXHHEXXHHEXXH (conserved)
Transmembrane domains4 predicted4 confirmed4-5 predicted4 typical
RegulationStress-responsiveσE regulonStress-responsiveVarious stress regulons
Genomic contextVaries by strainNear heat shock genesOften near cell wall genesVarious arrangements

Functional Differentiation:

  • E. coli HtpX functions in coordination with FtsH in a membrane protein quality control system

  • Mycobacterial HtpX may play additional roles in cell wall maintenance

  • Brucella HtpX likely participates in stress response pathways critical for intracellular survival, similar to the observed role of other proteases like CtpA

Structural Differences:

  • Species-specific insertions or deletions in loop regions may affect substrate specificity

  • C-terminal domain variations could influence protein-protein interactions or regulatory mechanisms

  • Bacterium-specific co-factors or binding partners might modulate activity in different species

These differences highlight the potential for Brucella-specific functions of HtpX that could be exploited for targeted therapeutic development or specific diagnostic applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.