Recombinant Brucella canis UPF0283 membrane protein BCAN_A1047 (BCAN_A1047)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Full Length Brucella canis UPF0283 membrane protein BCAN_A1047 (BCAN_A1047) is a protein that is expressed in E. coli . It is a full-length protein consisting of 357 amino acids and has an N-terminal His tag . The protein's purity is greater than 90%, as determined by SDS-PAGE . The gene name for this protein is BCAN_A1047, and its synonyms include BCAN_A1047 and UPF0283 membrane protein BCAN_A1047. The UniProt ID is A9MB47 .

Characteristics

CharacteristicDescription
SpeciesBrucella canis
SourceE. coli
TagHis
Protein LengthFull Length (1-357aa)
FormLyophilized powder
AA SequenceMSDKTPRKPTAFRLEQPARVSAASEQEEPRRPRAVKDLEQITPQADVFDLTDDEAAELEI LDPAFEAPERKGWSLSRILFGALGILVSFAIGIWTEDLIRALFARADWLGWTALGVAMVA LAAFAAIILRELVALRRLASVQHLRKDAADAAERDDMAAARKAVDALRTIAAGIPETAKG RQLLDSLTDDIIDGRDLIRLAETEILRPLDREARTLVLNASKRVSIVTAISPRALVDIGY VIFESARLIRRLSQLYGGRPGTFGFIKLARRVIAHLAVTGTIAMGDSVIQQLVGHGLASR LSAKLGEGVVNGLMTARIGIAAMDVVRPFPFNAEKRPGIGDFIGDLARLNSDRNARK
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃ is recommended

Structure

Proteins are composed of amino acids linked by peptide bonds . The sequence of amino acids determines the protein's primary structure . The recombinant Brucella canis BCAN_A1047 protein consists of a sequence of 357 amino acids .

Secondary structures, such as α-helices and β-sheets, arise from hydrogen bonds between the main chain NH and CO groups of neighboring amino acids .

  • α-helices Alpha-helices are the most common secondary structure in proteins . They have 3.6 amino acids per turn, with a hydrogen bond formed between every fourth residue . The average length is 10 amino acids, but it can vary .

  • β-sheets Beta-sheets resemble a zigzag pattern and are stabilized by hydrogen bonds . Parallel beta-sheets have amino and carboxyl ends that line up, while anti-parallel configurations have the amino end lining up with the carboxyl end .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
BCAN_A1047; UPF0283 membrane protein BCAN_A1047
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-357
Protein Length
full length protein
Species
Brucella canis (strain ATCC 23365 / NCTC 10854)
Target Names
BCAN_A1047
Target Protein Sequence
MSDKTPRKPTAFRLEQPARVSAASEQEEPRRPRAVKDLEQITPQADVFDLTDDEAAELEI LDPAFEAPERKGWSLSRILFGALGILVSFAIGIWTEDLIRALFARADWLGWTALGVAMVA LAAFAAIILRELVALRRLASVQHLRKDAADAAERDDMAAARKAVDALRTIAAGIPETAKG RQLLDSLTDDIIDGRDLIRLAETEILRPLDREARTLVLNASKRVSIVTAISPRALVDIGY VIFESARLIRRLSQLYGGRPGTFGFIKLARRVIAHLAVTGTIAMGDSVIQQLVGHGLASR LSAKLGEGVVNGLMTARIGIAAMDVVRPFPFNAEKRPGIGDFIGDLARLNSDRNARK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is BCAN_A1047 and what is its basic structural composition?

BCAN_A1047 is a membrane protein from Brucella canis, consisting of 357 amino acids in its full-length form . As a membrane protein, it is embedded in the bacterial cell membrane and likely contains transmembrane domains. The protein belongs to the UPF0283 family, a group of proteins with unknown function that share sequence similarities across bacterial species.

The recombinant form of this protein can be produced in E. coli expression systems with a His-tag for purification purposes . While detailed three-dimensional structural information is limited, researchers can infer potential structural characteristics through comparative analysis with other bacterial membrane proteins and bioinformatic prediction tools.

How does BCAN_A1047 compare to other outer membrane proteins in Brucella species?

BCAN_A1047 differs from the well-studied outer membrane proteins like Omp31, Omp25, and Omp2b in Brucella canis. Unlike Omp31, which has been extensively researched and shows only one nucleotide substitution between B. canis and B. melitensis versions , the conservation of BCAN_A1047 across Brucella species requires further investigation.

Brucella canis is naturally rough due to the lack of O-polysaccharide chain in its lipopolysaccharide, which affects the accessibility of membrane proteins to antibodies . This characteristic influences how BCAN_A1047 might be exposed on the bacterial surface compared to other Brucella species' membrane proteins. Researchers should consider this when designing experiments involving antibody binding or immunological detection.

What are the recommended expression and purification methods for recombinant BCAN_A1047?

For optimal expression of recombinant BCAN_A1047, an E. coli expression system with His-tag fusion is recommended . The purification protocol should include:

  • Bacterial cell lysis using methods suitable for membrane proteins (e.g., sonication or high-pressure homogenization)

  • Membrane fraction isolation through differential centrifugation

  • Solubilization of membrane proteins using appropriate detergents (e.g., n-dodecyl β-D-maltoside or CHAPS)

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin to capture His-tagged BCAN_A1047

  • Size exclusion chromatography for further purification and buffer exchange

For improved protein stability, consider incorporating glycerol (10-15%) and reducing agents in your storage buffer. Validate protein identity and purity using SDS-PAGE, Western blotting, and mass spectrometry techniques.

How should I design experiments to study BCAN_A1047's role in Brucella canis pathogenesis?

Designing experiments to elucidate BCAN_A1047's role in pathogenesis requires a multi-faceted approach:

  • Gene knockout/knockdown studies: Create BCAN_A1047 deletion mutants in B. canis and assess virulence changes in cellular and animal models.

  • Complementation experiments: Reintroduce the functional gene to mutant strains to confirm phenotype restoration.

  • Blocking studies: Develop antibodies against BCAN_A1047 and test their ability to neutralize bacterial infection.

  • Proper controls: Include:

    • Wild-type B. canis strains

    • Mutants of unrelated genes

    • Complemented mutant strains

    • Heat-killed bacteria

  • Appropriate blocking design: Group experimental units to reduce variability within blocks, enhancing detection of treatment effects .

This approach follows established principles for investigating membrane proteins in bacterial pathogenesis while incorporating good experimental design practices to minimize bias and variability.

What techniques are most effective for analyzing BCAN_A1047 interaction with host cell receptors?

To effectively analyze BCAN_A1047 interactions with host cell receptors, employ these methodological approaches:

  • Surface Plasmon Resonance (SPR): Provides real-time binding kinetics and affinity measurements. Immobilize purified BCAN_A1047 on sensor chips and flow potential host receptors across to measure binding parameters.

  • Pull-down assays: Use His-tagged BCAN_A1047 to capture interacting host proteins from cell lysates, followed by mass spectrometry identification.

  • Yeast two-hybrid or bacterial two-hybrid systems: Screen for potential interactions in vivo.

  • Crosslinking studies: Apply membrane-impermeable crosslinkers to intact cells infected with B. canis to capture transient protein-protein interactions.

  • Microscopy techniques: Employ confocal microscopy with fluorescently labeled BCAN_A1047 to track localization and co-localization with host receptors.

For each technique, implement proper controls including non-interacting proteins and blocking peptides to validate specificity. The choice of technique should align with your specific research question, considering factors such as sensitivity requirements and availability of purified interaction partners.

What are the key considerations for designing immunization experiments with BCAN_A1047?

When designing immunization experiments with BCAN_A1047, consider these methodological aspects:

  • Antigen preparation: Use highly purified recombinant BCAN_A1047 with confirmed structural integrity. Consider both full-length protein and selected epitope peptides.

  • Adjuvant selection: Based on findings with other Brucella proteins, test multiple adjuvants such as:

AdjuvantAdvantagesDisadvantages
Incomplete Freund's Adjuvant (IFA)Strong immune responsePotential for abscess formation
Aluminum hydroxide (HA)Well-tolerated, human-approvedModerate immune stimulation
Quil AStrong humoral and cellular responsePotential reactogenicity
Montanide IMS 3012 VGPRGood immune stimulationVariable responses
  • Immunization schedule: Include prime-boost protocols similar to those used with Omp31, which showed protection against B. canis .

  • Challenge model: Use standardized B. canis challenge strains (such as ATCC RM6/66) with defined bacterial loads following protocols similar to those used in Omp31 studies .

  • Outcome measurements: Assess both humoral (antibody titers, isotype profiles) and cellular (cytokine production, T-cell proliferation) immune responses. Quantify bacterial burden in spleens post-challenge as a protection measure .

  • Ethical considerations: Follow appropriate animal welfare guidelines as established in research facilities .

This approach incorporates lessons learned from successful Omp31 immunization studies while adapting methods specifically for BCAN_A1047.

How might BCAN_A1047 contribute to vaccine development against Brucella canis?

BCAN_A1047's potential as a vaccine candidate should be evaluated through a systematic research pathway:

  • Immunogenicity assessment: Determine if BCAN_A1047 elicits strong antibody and T-cell responses in animal models. Unlike smooth Brucella species, B. canis's rough nature makes membrane proteins like BCAN_A1047 potentially more accessible to antibodies .

  • Protection studies: Following the methodological framework used for Omp31, assess BCAN_A1047's protective efficacy through bacterial load reduction in spleens post-challenge . The benchmark table below shows protection levels achieved with Omp31, providing a comparative baseline:

Vaccine (n = 5)AdjuvantLog10 B. canis in the spleenLog unit of protection
PBS6.18 ± 0.11
rOmp31Quil A4.14 ± 0.681.86
rOmp31Montanide4.63 ± 0.501.42
rOmp31IFA4.37 ± 0.361.66
rOmp31HA4.37 ± 0.821.65
HKBCIFA2.25 ± 0.583.48
  • Prime-boost strategies: Consider DNA vaccination followed by protein boost, similar to the pCIOmp31+boost approach that provided significant protection against B. canis .

  • Multi-antigen formulations: Investigate combining BCAN_A1047 with other immunogenic proteins like Omp31 or chimeric constructs to enhance protective efficacy.

  • Cross-protection analysis: Evaluate if BCAN_A1047-based immunity provides protection against different B. canis strains and potentially other Brucella species.

Remember that while subunit vaccines may not achieve the protection levels of whole-cell vaccines (like HKBC), they typically offer advantages in safety and diagnostic compatibility .

What cellular pathways and host responses are potentially affected by BCAN_A1047 during infection?

Understanding BCAN_A1047's role in host-pathogen interactions requires investigation of multiple cellular pathways:

  • Pattern recognition receptor (PRR) activation: Determine if BCAN_A1047 interacts with Toll-like receptors (TLRs) or NOD-like receptors using reporter cell systems and knockout models.

  • Cytokine profiling: Measure both pro-inflammatory (TNF-α, IL-12, IFN-γ) and anti-inflammatory (IL-10, TGF-β) cytokine responses to purified BCAN_A1047 in immune cell cultures.

  • Intracellular trafficking: Track the localization of fluorescently-labeled BCAN_A1047 in infected cells to determine if it:

    • Alters phagosome maturation

    • Affects endosomal trafficking

    • Translocates to specific cellular compartments

  • Cell death modulation: Assess if BCAN_A1047 affects apoptosis, pyroptosis, or necroptosis pathways in host cells using flow cytometry with appropriate markers.

  • Signaling pathway analysis: Investigate activation/inhibition of MAPK, NF-κB, and JAK-STAT pathways in the presence of BCAN_A1047 through phosphorylation studies.

For each pathway, implement appropriate controls and confirmatory experiments to establish causality rather than correlation. This comprehensive approach will help distinguish BCAN_A1047's specific effects from general bacterial infection responses.

How can protein-protein interaction networks involving BCAN_A1047 be characterized and validated?

Characterizing BCAN_A1047's interaction networks requires an integrated experimental strategy:

  • Initial network mapping: Employ high-throughput screening methods:

    • Bacterial two-hybrid system

    • Co-immunoprecipitation followed by mass spectrometry

    • Protein microarrays with labeled BCAN_A1047

  • Bioinformatic filtering: Apply computational approaches to prioritize interactions:

    • Biological relevance scoring

    • Domain-domain interaction probability

    • Conservation analysis across Brucella species

  • Validation hierarchy: Confirm high-priority interactions through multiple methods:

    • Co-immunoprecipitation with specific antibodies

    • Microscopy-based co-localization

    • FRET/BRET to demonstrate proximity in living cells

    • Surface plasmon resonance for binding kinetics

  • Functional confirmation: Establish biological significance through:

    • Site-directed mutagenesis of interaction interfaces

    • Competition assays with peptide inhibitors

    • Phenotypic analysis of interaction-deficient mutants

  • Network contextualization: Place validated interactions in broader cellular context:

    • Pathway enrichment analysis

    • Temporal dynamics during infection

    • Comparison with other bacterial membrane protein interactomes

This systematic approach ensures both discovery and validation, allowing researchers to distinguish between direct interactions and indirect associations within complex biological systems.

How should contradictory results in BCAN_A1047 localization studies be reconciled?

When faced with contradictory results regarding BCAN_A1047 localization:

  • Methodological analysis: First examine differences in experimental procedures:

    • Cell fixation methods (chemical vs. cryo-fixation)

    • Antibody specificity and validation

    • Microscopy resolution limitations

    • Sample preparation artifacts

  • Biological variability assessment: Consider if contradictions reflect actual biological phenomena:

    • Growth phase-dependent localization

    • Strain-specific differences

    • Host cell type-dependent distribution

    • Response to environmental stimuli

  • Triangulation approach: Implement multiple complementary techniques:

    • Biochemical fractionation with Western blotting

    • Super-resolution microscopy

    • Electron microscopy with immunogold labeling

    • Live-cell imaging with fluorescent protein fusions

  • Quantitative analysis: Apply statistical rigor to localization data:

    • Blinded scoring by multiple observers

    • Automated image analysis algorithms

    • Appropriate statistical tests for distribution patterns

    • Power analysis to ensure adequate sampling

  • Experimental design improvements: Apply blocking techniques to control for nuisance variables that might affect protein localization .

Remember that apparent contradictions often reveal biological complexity rather than experimental error. Document all experimental conditions thoroughly to enable accurate cross-laboratory comparisons and metanalysis.

What statistical approaches are most appropriate for analyzing BCAN_A1047 expression under different experimental conditions?

Selecting appropriate statistical methods for analyzing BCAN_A1047 expression data requires careful consideration:

  • Exploratory data analysis:

    • Assess normality using Shapiro-Wilk or Kolmogorov-Smirnov tests

    • Check for homogeneity of variance with Levene's test

    • Identify potential outliers through box plots and Z-scores

    • Create descriptive statistics tables for all experimental groups

  • Appropriate statistical tests based on experimental design:

    • Two conditions: t-test (parametric) or Mann-Whitney (non-parametric)

    • Multiple conditions: ANOVA (parametric) or Kruskal-Wallis (non-parametric)

    • Repeated measures: RM-ANOVA or Friedman test

    • Complex designs: Mixed-effects models or MANOVA

  • Post-hoc testing and multiple comparisons:

    • Apply Bonferroni, Tukey, or Dunnett corrections as appropriate

    • Report adjusted p-values alongside raw values

    • Calculate effect sizes to determine biological significance

  • Regression models for continuous predictors:

    • Linear regression for simple relationships

    • Multiple regression for complex factor interactions

    • Non-linear models when appropriate

  • Blocking and randomization techniques to reduce experimental variability and enhance statistical power to detect true effects .

When reporting results, include both statistical significance indicators and confidence intervals. Visualize data with appropriate plots that represent both central tendency and variation, allowing readers to assess the biological relevance of findings independently.

How can functional annotation of BCAN_A1047 be improved given limited direct experimental data?

To improve functional annotation of BCAN_A1047 despite limited direct experimental data:

  • Comparative genomics approaches:

    • Identify orthologous proteins across bacterial species

    • Perform phylogenetic analysis to trace evolutionary relationships

    • Examine gene neighborhood conservation patterns

    • Analyze cross-species expression correlation networks

  • Structural bioinformatics methods:

    • Generate 3D structure predictions using AlphaFold or RoseTTAFold

    • Identify potential binding pockets or catalytic sites

    • Compare structural features with functionally characterized proteins

    • Dock potential ligands or interaction partners in silico

  • Systems biology integration:

    • Incorporate BCAN_A1047 into metabolic models of Brucella

    • Analyze transcriptomic co-expression patterns

    • Examine protein-protein interaction network positioning

    • Apply machine learning to predict function from multiple data types

  • Targeted experimental validation:

    • Design experiments to test highest-confidence functional predictions

    • Use gene knockout phenotyping to observe functional effects

    • Apply chemical genetics to identify small molecule interactions

    • Perform complementation studies with site-directed mutants

  • Community annotation and collaboration:

    • Establish a central repository for BCAN_A1047 research findings

    • Implement standardized protocols for functional characterization

    • Encourage data sharing across research groups

This integrated approach leverages computational predictions to guide focused experimental validation, making efficient use of limited resources while systematically expanding our understanding of BCAN_A1047's biological roles.

How can BCAN_A1047 research findings be translated into practical diagnostic applications?

Translating BCAN_A1047 research into diagnostic applications requires:

  • Antigen-based assay development:

    • ELISA systems using purified recombinant BCAN_A1047

    • Lateral flow immunoassays for point-of-care testing

    • Microarray-based multiplex detection systems

    • Biosensor platforms with immobilized antibodies

  • Validation parameters to establish:

    • Analytical sensitivity and specificity

    • Clinical sensitivity and specificity

    • Cross-reactivity profiles with other bacterial species

    • Stability under field conditions

    • Reproducibility across different laboratories

  • Comparative evaluation against existing diagnostics:

    • Head-to-head comparison with current serological tests

    • Correlation with bacterial culture results

    • Performance in various stages of infection

    • Ability to distinguish active from past infection

  • Sample type optimization:

    • Serum/plasma testing protocols

    • Whole blood direct detection methods

    • Tissue sample processing techniques

    • Non-invasive sample collection approaches

  • Integration with other Brucella antigens:

    • Complementary use with Omp31, which has demonstrated diagnostic value in B. canis infection

    • Multiplex platforms targeting multiple antigens simultaneously

When developing these applications, researchers should consider the specific challenges of canine brucellosis diagnosis, including the need for tests applicable in both clinical and field settings, compatibility with existing diagnostic workflows, and potential for automation in high-throughput scenarios.

What emerging technologies could accelerate BCAN_A1047 research?

Several cutting-edge technologies could significantly advance BCAN_A1047 research:

  • CRISPR-Cas9 gene editing:

    • Precise modification of BCAN_A1047 in the native Brucella genome

    • Creation of reporter strains with fluorescent protein fusions

    • Development of inducible expression systems

    • High-throughput functional screening

  • Single-cell technologies:

    • Single-cell RNA-seq to examine host response heterogeneity

    • Mass cytometry to profile immune response at single-cell resolution

    • Microfluidic systems for phenotypic screening

    • Live-cell imaging of host-pathogen interactions

  • Advanced structural biology approaches:

    • Cryo-electron microscopy for membrane protein structures

    • High-field NMR spectroscopy for dynamic interactions

    • Hydrogen-deuterium exchange mass spectrometry

    • X-ray free-electron laser crystallography

  • Systems biology integration:

    • Multi-omics data integration (genomics, transcriptomics, proteomics, metabolomics)

    • Machine learning for pattern recognition

    • Network biology approaches to contextual function

    • Computational modeling of host-pathogen interactions

  • Drug development platforms:

    • Fragment-based drug discovery targeting BCAN_A1047

    • Virtual screening and molecular dynamics simulations

    • Peptidomimetic development as inhibitors

    • Nanobody and single-domain antibody technologies

These emerging technologies could help overcome current research bottlenecks, providing deeper insights into BCAN_A1047's structure, function, and role in pathogenesis, while accelerating the development of novel therapeutic and preventive strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.