Recombinant Brucella melitensis biotype 1 Aquaporin Z (aqpZ)

Shipped with Ice Packs
In Stock
Cat. No.
BT2050794
Source
in vitro E.coli expression system
Synonyms
aqpZ; BMEI0070; Aquaporin Z
Quick Inquiry

Description

Expression and Purification

The protein is synthesized using an E. coli expression system, optimized for high yield and stability:

  • Expression System: E. coli

  • Purification Method: Affinity chromatography (His-tag)

  • Storage Conditions:

    • Liquid Form: 6 months at -20°C/-80°C

    • Lyophilized Form: 12 months at -20°C/-80°C

  • Buffer: Tris-based with 50% glycerol

Key Notes:

  • Repeated freeze-thaw cycles degrade stability; working aliquots stored at 4°C for ≤1 week .

  • Purity confirmed via SDS-PAGE and Western blot .

Immune Response Mechanisms

  • Recombinant Brucella proteins (e.g., Omp31, BCSP31) elicit T helper 1 (Th1) responses dominated by IgG2a and interferon-gamma (IFN-γ) production .

  • CD4+ T cells mediate protection against Brucella infection, while CD8+ T cells play a minor role .

Hypothesized Role of aqpZ

  • As an aquaporin, aqpZ may regulate osmotic stress responses during intracellular survival in host macrophages .

  • Structural homology to E. coli aquaporin Z implies involvement in water transport and biofilm formation .

Applications in Research

Recombinant aqpZ is utilized in:

ApplicationPurpose
Diagnostic AssaysAntigen in ELISA for brucellosis detection
Vaccine DevelopmentCandidate antigen for subunit vaccines (similar to Omp31 )
Structural BiologyCrystallization studies to map pore-forming domains
Host-Pathogen StudiesInvestigating osmotic adaptation in intracellular niches

Comparative Analysis with Other Brucella Recombinant Proteins

ProteinFunctionImmune ResponseProtective Efficacy
aqpZWater transport, osmotic regulationNot yet characterizedUnknown
Omp31Outer membrane proteinTh1 response, CD4+ T-cell mediated60-70% protection in mice
BCSP31Cell surface antigenIgG2a dominance, macrophage activationSignificant spleen clearance
CP24 (RRF)Ribosome recycling factorMixed IgG1/IgG2a, no protectionNon-protective

Key Challenges and Future Directions

  • Functional Characterization: The role of aqpZ in Brucella pathogenicity remains unvalidated .

  • Vaccine Potential: Requires in vivo studies to assess immunogenicity and protection levels, as seen with Omp31 .

  • Stability Optimization: Lyophilized formulations may enhance shelf life for field applications .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
aqpZ; BMEI0070; Aquaporin Z
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-228
Protein Length
full length protein
Species
Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)
Target Names
aqpZ
Target Protein Sequence
MLNKLSAEFFGTFWLVFGGCGSAILAAAFPELGIGFLGVALAFGLTVLTMAYAVGGISGGHFNPAVSLGLTVAGRLPAKDLIPYWVAQVLGAIAAAAILYVIASGKDGFSAGGLASNGYGELSPGGYSMMAGLLIEIILTAFFIIIILGSTSSLAPAGFAPIAIGFGLTLIHLVSIPVTNTWVNPARSTGVALFADTAALSQLWLFWVAPLVGAVIGAIIWKGLLGRD
Uniprot No.
Q9L772

Target Background

Function
Facilitates water transport across membranes. It may also play a role in adapting to changes in intravacuolar pH or osmolarity.
Database Links

KEGG: bme:BMEI0070

STRING: 224914.BAWG_0126

Protein Families
MIP/aquaporin (TC 1.A.8) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.