Recombinant Brucella melitensis biotype 1 ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant B. melitensis atpB is synthesized via heterologous expression systems, typically in E. coli or other bacterial hosts, followed by purification using affinity chromatography. Key technical specifications include:

ParameterDetailsSource
Expression HostNot explicitly stated (commonly E. coli)
Tag TypeDetermined during production (e.g., His-tag, GST-tag)
Purity≥90% (typical for recombinant proteins)
StabilityStable at -20°C; working aliquots stored at 4°C for ≤1 week

The recombinant protein is supplied in a Tris-based buffer with glycerol to maintain stability during storage .

Diagnostic Use

Recombinant atpB is employed in serological assays (e.g., ELISA) to detect anti-Brucella antibodies. Its conserved sequence across Brucella species enhances specificity in diagnosing brucellosis .

Vaccine Development

While not directly tested in the provided sources, ATP synthase subunits are explored as vaccine candidates due to their immunogenicity. For example, outer membrane proteins (e.g., Omp31) and chaperones (e.g., trigger factor) have shown protective efficacy in murine models .

Mechanistic Studies

AtpB’s role in Brucella’s intracellular survival is inferred from its function in ATP synthesis. Brucella modulates host pathways like the Unfolded Protein Response (UPR) to subvert lysosomal trafficking, but direct links to ATP synthase remain unexplored .

Genomic Context

The atpB gene is located on chromosome I of B. melitensis 16M (BMEI1546). The genome contains two circular chromosomes (2,117,144 bp and 1,177,787 bp), with housekeeping genes distributed across both . ATP synthase subunits (a and b) are part of the F₀F₁-ATP synthase complex, absent in traditional secretion systems but critical for pathogen survival .

Comparative Analysis with ATP Synthase Subunit b (atpF)

FeatureSubunit a (atpB)Subunit b (atpF)
Uniprot IDQ8YFH6Q8YFH7
Locus NameBMEI1546BMEI1544
AA Length249208
FunctionProton translocation (F₀ sector)Stabilizes F₀F₁ interaction; anchors F₀ to F₁
Sequence HomologyConserved across Brucella spp.Conserved across Brucella spp.

Subunits a and b form a critical interface in the F₀ sector, with subunit b stabilizing the complex’s structural integrity .

Future Directions

  1. Antimicrobial Targeting: ATP synthase inhibitors (e.g., bedaquiline) could disrupt Brucella energy production, though resistance mechanisms (e.g., efflux pumps) complicate efficacy .

  2. Structural Studies: Cryo-EM of the F₀F₁ complex in B. melitensis could elucidate atpB’s interaction dynamics.

  3. Diagnostic Optimization: Pairing atpB with other antigens (e.g., Omp31) may enhance ELISA sensitivity for brucellosis .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery time information.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; BMEI1546; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-249
Protein Length
full length protein
Species
Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)
Target Names
atpB
Target Protein Sequence
MANDPIHQFQVSRWIPIDVGGVDLSFTNVSAFMVATVVLASGFLYLTSSGRGLIPTRLQS VSEMAYEFVATSLRDSAGSKGMKFFPFVFSLFMFVLVANFIGLFPYFYTVTSQIIVTFAL SLLVIGTVIFYGFFKHGFGFLKLFVPSGVPGIIVPLVVLIEIISFLSRPISLSVRLFANM LAGHITLKVFAGFVVSLSSLGALGIGGAVLPLLMTVAITALEFLVAFLQAYVFTVLTCMY INDAVHPGH
Uniprot No.

Target Background

Function
As a key component of the proton channel, ATP synthase subunit a (atpB) plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Brucella melitensis ATP synthase subunit a (atpB) and why is it significant in research?

ATP synthase subunit a (atpB) is a critical component of the ATP synthase complex in Brucella melitensis, encoded by the atpB gene (locus BMEI1546). This 249-amino acid membrane protein plays an essential role in bacterial energy metabolism by facilitating proton translocation across the membrane during oxidative phosphorylation. As a membrane protein from a significant zoonotic pathogen, atpB represents a potential target for diagnostic, therapeutic, and vaccine development efforts against brucellosis, a disease that poses significant public health problems and economic losses worldwide .

  • How is recombinant B. melitensis atpB typically expressed and purified?

Recombinant B. melitensis atpB is typically expressed in Escherichia coli expression systems such as E. coli BL21, similar to other recombinant Brucella proteins . The expression process involves:

  • Gene synthesis or PCR amplification of the atpB coding sequence

  • Cloning into an appropriate expression vector

  • Transformation into E. coli

  • Induction of expression under optimized conditions

  • Cell harvesting and lysis

  • Purification by affinity chromatography (if tagged) or other chromatographic methods

The purified protein is typically stored in a Tris-based buffer with 50% glycerol to maintain stability during storage . Quality control includes SDS-PAGE and Western blotting to confirm purity and identity.

  • What structural characteristics of B. melitensis atpB are important for vaccine development?

The atpB protein contains several transmembrane domains with hydrophilic loops that may be exposed and serve as epitopes for immune recognition. According to the amino acid sequence information, the protein consists of 249 amino acids with alternating hydrophobic and hydrophilic regions . For vaccine development, identifying epitopes that can stimulate both humoral and cellular immune responses is critical. Research on other Brucella proteins has demonstrated that specific peptides can induce protective immunity comparable to whole proteins , suggesting that identifying immunodominant epitopes within atpB could lead to effective peptide-based vaccines.

Advanced Research Questions

  • What methodologies are recommended for analyzing the immunogenicity of recombinant B. melitensis atpB?

Based on successful approaches with other Brucella antigens, recommended methodologies include:

Immune ParameterMethodologyKey Measurements
Humoral immunityELISAIgG, IgG1, IgG2 titers
Cellular immunityLymphocyte proliferationProliferation index (PI)
Cytokine profileELISA/ELISPOTIFN-γ, IL-2, IL-10, IL-4 levels
T-cell subsetsFlow cytometryCD4+/CD8+ responses
Protective efficacyChallenge studiesBacterial load reduction

Researchers should evaluate both humoral and cellular responses, with particular emphasis on Th1-type immunity (IFN-γ, IL-2), which has been shown to be critical for protection against Brucella infection . Spleen cell proliferation assays and cytokine analysis following in vitro stimulation with the recombinant protein provide valuable information about cellular immunity .

  • How can researchers assess T-cell epitopes within B. melitensis atpB?

Assessment of T-cell epitopes within atpB should employ a multi-faceted approach:

  • In silico prediction using algorithms designed to identify MHC class I and II binding peptides

  • Synthesis of overlapping peptides spanning the entire atpB sequence

  • T-cell stimulation assays using peptides to identify regions that activate T cells from immunized or infected animals

  • Measurement of cytokine production (particularly IFN-γ and IL-2) in response to peptide stimulation

  • In vivo T-cell subset depletion studies to determine which T-cell populations recognize specific epitopes

Research on other Brucella proteins has demonstrated that specific peptides can induce protective immunity. For example, a 27-amino acid peptide derived from Omp31 (aa 48-74) induced protection against B. melitensis infection comparable to the whole recombinant protein .

  • What are the challenges in developing atpB-based vaccine candidates?

Developing effective atpB-based vaccines presents several challenges:

  • Expression and solubility issues: As a membrane protein, atpB may present difficulties in expression and purification while maintaining native conformation.

  • Immune response balance: The vaccine must stimulate both humoral and cellular immunity, with emphasis on Th1 responses (IFN-γ, IL-2) critical for Brucella protection .

  • Adjuvant selection: The choice of adjuvant significantly impacts immune response quality. Studies with other Brucella proteins have successfully used chitin and incomplete Freund's adjuvant .

  • Protective efficacy comparison: New vaccine candidates must demonstrate protection comparable to or better than established vaccines like Rev.1 .

  • Cross-protection: The vaccine should ideally protect against multiple Brucella species or strains.

  • Epitope accessibility: In smooth Brucella strains, the O-polysaccharide of LPS may hinder access to membrane protein epitopes , potentially limiting vaccine efficacy.

  • How do researchers measure protective immunity induced by recombinant B. melitensis proteins?

Protective immunity assessment involves multiple parameters:

Assessment TypeMethodologyKey Indicators
Humoral immunityELISASpecific IgG levels and subclasses
Cellular immunityCytokine assaysIFN-γ, IL-2 production
Lymphocyte proliferationPI in response to antigen
Cytotoxic activityLysis of infected macrophages
Protective efficacyChallenge studiesBacterial load in spleen/organs

Protection is typically quantified by challenging immunized animals with virulent B. melitensis and measuring bacterial burden in the spleen compared to control animals . High levels of IFN-γ and IL-2 production by T cells (particularly CD4+ T cells) correlate with protection against Brucella infection . In vivo depletion of T-cell subsets has revealed that for some Brucella antigens, protection is primarily mediated by CD4+ T cells, with limited contribution from CD8+ T cells .

Methodological Approaches

  • What protocols are most effective for designing multi-epitope B. melitensis vaccine candidates?

Effective protocols for designing multi-epitope vaccines include:

  • Epitope identification and selection:

    • Identify immunogenic proteins through techniques like 2D gel electrophoresis and MALDI-TOF

    • Use in silico methods to predict B and T cell epitopes within these proteins

    • Select epitopes that induce strong Th1 responses

  • Construct design:

    • Connect selected epitopes using appropriate linkers to maintain independent folding

    • Ensure proper spacing and orientation to preserve epitope accessibility

    • Consider codon optimization for the expression system

  • Expression and purification:

    • Express in E. coli BL21 or similar systems

    • Purify using appropriate chromatographic methods

    • Verify protein integrity and epitope preservation

  • Immunological validation:

    • Test the multi-epitope construct for ability to stimulate both B and T cell responses

    • Compare immune responses to those induced by individual epitopes or whole proteins

    • Assess protective efficacy in animal models

This approach has proven successful with other Brucella antigens. For example, a multi-epitope polypeptide (MEL) containing 19 peptides from various Brucella antigens induced protection comparable to the commercial Rev.1 vaccine .

  • How can researchers optimize adjuvant selection for B. melitensis recombinant protein vaccines?

Adjuvant optimization is critical for enhancing vaccine efficacy:

AdjuvantImmune Response ProfileApplication Notes
ChitinActivates macrophages, induces IL-12, TNF-α, IL-18, promotes IFN-γ productionSuccessfully used with recombinant Brucella proteins
Incomplete Freund's AdjuvantPromotes strong Th1 responsesEffective with recombinant Omp31
Aluminum saltsGenerally biases toward Th2 responsesMay be less ideal for Brucella vaccines
LiposomesCan deliver antigens to APCsPotential for membrane protein delivery

Selection criteria should include:

  • Ability to induce Th1-biased responses (crucial for Brucella protection)

  • Safety profile for intended host species

  • Stability when formulated with the antigen

  • Reproducible manufacturing process

Researchers should conduct comparative studies testing different adjuvants with their recombinant protein to identify optimal formulations. The search results indicate that chitin particles activate alveolar macrophages, leading to the expression of cytokines that promote IFN-γ production, making it particularly suitable for Brucella vaccines .

  • What analytical methods should be used to characterize recombinant B. melitensis atpB?

Comprehensive characterization requires multiple analytical approaches:

  • Physicochemical characterization:

    • SDS-PAGE for purity and molecular weight determination

    • Western blotting for identity confirmation

    • Mass spectrometry for precise molecular weight and sequence verification

    • Circular dichroism for secondary structure assessment

  • Functional characterization:

    • ATP synthase activity assays (if functional activity is relevant)

    • Membrane protein reconstitution studies

    • Protein-protein interaction studies with other ATP synthase components

  • Immunological characterization:

    • ELISA using sera from infected animals to assess antigenic recognition

    • T-cell stimulation assays to evaluate cellular recognition

    • Epitope mapping to identify immunodominant regions

  • Stability assessment:

    • Accelerated and real-time stability studies

    • Freeze-thaw stability

    • Formulation optimization for long-term storage

These methods ensure that the recombinant protein maintains its structural integrity and immunological properties, which are essential for vaccine development and immunological studies.

Research Applications

  • How can recombinant B. melitensis atpB contribute to improved diagnostic methods for brucellosis?

Recombinant atpB could enhance brucellosis diagnostics through:

  • ELISA-based assays:

    • Development of recombinant protein-based ELISAs for antibody detection

    • Potential for improved specificity compared to traditional tests using bacterial extracts

    • Ability to distinguish vaccinated from infected animals if atpB is not a major component of vaccine strains

  • Multiple antigen testing:

    • Inclusion of atpB in multi-antigen panels to improve sensitivity and specificity

    • Combination with other established Brucella antigens for comprehensive detection

  • Point-of-care diagnostics:

    • Development of rapid tests using recombinant antigens

    • Field-applicable diagnostics for resource-limited settings

  • Cellular immunity assessment:

    • In vitro tests measuring T-cell responses to atpB as indicators of exposure or infection

Current serological methods for brucellosis diagnosis include agglutination tests and ELISA . Recombinant protein-based assays could offer advantages in terms of standardization, specificity, and the ability to differentiate infected from vaccinated animals.

  • What is the potential of atpB epitopes for rational vaccine design against B. melitensis?

The potential of atpB epitopes for rational vaccine design includes:

  • Peptide-based vaccines:

    • Identification of protective epitopes within atpB could lead to synthetic peptide vaccines

    • Multiple epitopes could be combined into a single construct

    • Research with other Brucella proteins demonstrates that specific peptides can induce protection comparable to whole proteins

  • DNA vaccines:

    • Genes encoding atpB epitopes could be incorporated into DNA vaccine constructs

    • Potential for inducing both antibody and T-cell responses

  • Vectored vaccines:

    • atpB epitopes could be expressed in viral or bacterial vectors

    • Could enhance presentation to the immune system

  • Multi-epitope constructs:

    • Combination of atpB epitopes with epitopes from other Brucella antigens

    • Similar approaches with other antigens have shown promising results

Rational design based on protective epitopes offers advantages over whole-protein approaches, including better targeting of immune responses, reduced risk of adverse reactions, and potential for broader protection against multiple strains or species.

Experimental Design Considerations

  • What animal models are most appropriate for evaluating atpB-based vaccine candidates?

Selection of appropriate animal models is critical for vaccine evaluation:

Animal ModelAdvantagesLimitationsApplication
BALB/c miceWell-characterized, cost-effective, reagents availableNot natural hostsInitial screening, immune mechanism studies
Guinea pigsGood model for Brucella pathogenesisFewer immunological reagentsPreliminary efficacy studies
Sheep/GoatsNatural hosts for B. melitensisExpensive, facilities requiredAdvanced efficacy studies, target species validation
CamelsRelevant in regions where B. melitensis is endemic in camelsVery expensive, specialized facilitiesHost-specific studies in endemic regions

Animal model selection should be based on:

  • Study objectives (mechanism investigation vs. efficacy testing)

  • Stage of vaccine development

  • Available facilities and resources

  • Regulatory requirements for eventual approval

Initial screening in mice can identify promising candidates, followed by testing in guinea pigs and eventually in natural hosts. The search results describe successful use of both mice and guinea pigs for evaluating Brucella vaccine candidates.

  • How should researchers design studies to compare atpB-based vaccines with commercial vaccines?

Comparative study design should include:

  • Experimental groups:

    • atpB vaccine group(s) with different formulations/doses

    • Commercial vaccine positive control (e.g., Rev.1)

    • Adjuvant-only negative control

    • PBS negative control

  • Immunization protocol:

    • Standardized dose, route, and schedule

    • Multiple timepoints for immune response assessment

  • Challenge protocol:

    • Standardized challenge strain and dose

    • Multiple timepoints for bacterial load assessment

    • Comprehensive tissue sampling

  • Assessment parameters:

    • Humoral immunity: antibody titers and isotypes

    • Cellular immunity: cytokine profiles, T-cell responses

    • Protection: bacterial loads in spleen and other tissues

    • Safety: local and systemic adverse reactions

  • Statistical analysis:

    • Appropriate sample size determination

    • Rigorous statistical comparison methods

This approach allows direct comparison of new vaccine candidates with established vaccines like Rev.1, which is critical for regulatory approval and acceptance by the scientific community .

  • What methodological approaches are most effective for identifying protective mechanisms of atpB-based immunity?

Effective methodological approaches include:

  • In vivo T-cell subset depletion:

    • Administration of anti-CD4 or anti-CD8 antibodies during vaccination or challenge

    • Determination of which T-cell subsets are critical for protection

  • Adoptive transfer studies:

    • Transfer of immune cells from vaccinated animals to naive recipients

    • Test protection following challenge

    • Identify which cell populations confer protection

  • Cytokine neutralization:

    • Administration of antibodies against specific cytokines (e.g., IFN-γ)

    • Assess impact on vaccine-induced protection

  • Correlates of protection analysis:

    • Comprehensive immune parameter measurement

    • Correlation with protection levels

    • Identification of biomarkers that predict protection

  • In vitro functional assays:

    • Macrophage infection and bacterial killing assays

    • Assessment of antibody opsonization and neutralization

    • T-cell mediated lysis of infected cells

For other Brucella antigens, these approaches have revealed that protection is primarily mediated by CD4+ T cells producing IFN-γ and IL-2, with CD8+ T cells playing a more limited role . Similar methodologies would be valuable for understanding atpB-induced immunity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.