Recombinant Brucella melitensis biotype 1 ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
atpF; BMEI1544; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-208
Protein Length
full length protein
Species
Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)
Target Names
atpF
Target Protein Sequence
MFVSTAFAQTATESQPASTAGEHGAADAVHTETGVAHDAGHGSGVFPPFDSTHYASQVLW LAITFGLFYLFLSRVVLPRIGGVIETRRDRIAQDLEQAARLKQDADNAIAAYEQELAQAR SKAASIAEAAREKGKGEADAERASAEAVLESKLKEAEERIAAIKAKAMSDVGNIAEETMA TIVEQLLGLTADKASVSEAVKAIRASNA
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the extramembraneous catalytic F1 domain and the membrane-embedded proton channel F0 domain, connected by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits.
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is ATP synthase subunit b (atpF) in Brucella melitensis and what is its biological significance?

ATP synthase subunit b (atpF) is a component of the F-type ATPase in Brucella melitensis biotype 1, specifically identified in strain 16M (ATCC 23456/NCTC 10094) . It functions as part of the F0 sector of ATP synthase, which is crucial for energy metabolism in this bacterial pathogen . The protein consists of 208 amino acids and is encoded by the atpF gene (BMEI1544) . From an immunological perspective, this protein has been identified as immunoreactive in several proteomics studies of Brucella species, suggesting its potential role in host-pathogen interactions and immune response elicitation .

How does atpF expression differ between virulent and attenuated strains of B. melitensis?

Comparative proteomic studies between virulent wild-type strains and attenuated vaccine strains (like Rev.1) have shown differences in the expression levels of various proteins, including ATP synthase components . While specific data comparing atpF expression between strains is limited in the provided search results, proteomic analyses have identified ATP synthase subunits as differentially expressed under various conditions . These differences potentially contribute to altered metabolic capacities and possibly virulence characteristics. Research indicates that hfq mutant strains show differential abundance of 55 proteins including those involved in transport and metabolism, which may include ATP synthase components .

What are the optimal conditions for expressing recombinant B. melitensis atpF in E. coli expression systems?

For optimal expression of recombinant B. melitensis atpF in E. coli systems (such as BL21), researchers should consider:

  • Vector selection: A vector with an appropriate promoter (typically T7) and affinity tag compatibility

  • Induction parameters: IPTG concentration (typically 0.5-1.0 mM), induction temperature (often lowered to 25-30°C for membrane proteins), and duration (4-16 hours)

  • Culture conditions: Media composition (such as LB or 2xYT), appropriate antibiotic selection, and optimal cell density (OD600 0.6-0.8) before induction

  • Cell lysis: Gentle lysis methods to preserve protein structure, especially considering the protein's membrane-associated characteristics

The storage recommendations for the purified protein include keeping it in Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for long-term storage, avoiding repeated freeze-thaw cycles, and maintaining working aliquots at 4°C for up to one week .

What purification strategies yield the highest purity and functional activity for recombinant atpF?

Based on standard practices for membrane-associated proteins like atpF:

  • Initial capture: Affinity chromatography based on the tag used (His-tag, GST, etc.)

  • Secondary purification: Ion exchange chromatography to separate based on charge properties

  • Polishing step: Size exclusion chromatography to remove aggregates and obtain homogeneous protein

For membrane-associated proteins like atpF, the addition of appropriate detergents (such as mild non-ionic detergents) during extraction and purification is critical to maintain solubility and native conformation. Buffer optimization including pH, salt concentration, and stabilizing agents also significantly impacts final protein quality and functionality .

What analytical methods are most effective for validating the structure and function of purified recombinant atpF?

Multiple complementary analytical approaches should be employed:

  • Structural validation:

    • SDS-PAGE for purity and molecular weight confirmation

    • Western blotting using anti-atpF or tag-specific antibodies

    • Circular dichroism (CD) spectroscopy for secondary structure assessment

    • Mass spectrometry for precise mass determination and post-translational modifications

  • Functional validation:

    • ATP hydrolysis assays to measure enzymatic activity

    • Reconstitution experiments with other ATP synthase components

    • Membrane integration assays to assess proper folding and insertion

  • Immunological characterization:

    • ELISA to test reactivity with sera from infected animals/humans

    • 2D immunoblotting with specific antisera to confirm immunoreactivity patterns

What evidence supports the inclusion of atpF in subunit vaccine formulations against brucellosis?

Several lines of evidence support considering atpF for subunit vaccine development:

  • Multiple immunoproteomic studies have identified F0F1-type ATP synthase components, including subunit b, as immunoreactive in both bovine and human Brucella infections .

  • The F0F1 ATP synthase subunit beta was specifically noted as being identified for the first time as immunoreactive in Brucella studies, suggesting its potential novel contribution to vaccine development .

  • ATP synthase components induce strong antibody responses that could be beneficial in protective immunity, as evidenced by their detection in immunoblots with sera from infected hosts .

  • Research on multi-epitope proteins for Brucella has demonstrated that carefully selected epitopes from immunogenic proteins can provide protection comparable to traditional live vaccines like Rev.1, with specific metrics showing:

    • Comparable IFNγ and IL2 secretion

    • Similar levels of specific IgG production

    • Activation of cellular immunity with significant proliferation responses

What approaches can be used to identify and validate the most immunogenic epitopes of atpF for targeted vaccine design?

A comprehensive epitope mapping strategy involves:

  • In silico prediction:

    • Computational algorithms to predict B-cell and T-cell epitopes

    • Molecular dynamics simulations to assess epitope accessibility

    • Population coverage analysis for MHC binding predictions

  • Experimental validation:

    • Peptide synthesis of predicted epitopes

    • ELISA and ELISpot assays to measure antibody binding and T-cell responses

    • Flow cytometry to assess lymphocyte activation and proliferation

  • Epitope refinement:

    • Alanine scanning mutagenesis to identify critical residues

    • Structural studies (X-ray crystallography or cryo-EM) of epitope-antibody complexes

    • Cross-reactivity testing to ensure specificity

The methodology described in the research on multi-epitope proteins demonstrates the effectiveness of this approach, where 19 peptides of T and B epitopes were selected, ligated with linkers, and expressed in E. coli BL21, resulting in a recombinant protein that showed promising immunostimulatory properties .

How can atpF be utilized in diagnostic assays for brucellosis, and what are the sensitivity and specificity considerations?

ATP synthase subunit b can be integrated into diagnostic platforms for brucellosis using several approaches:

  • ELISA-based diagnostics:

    • Recombinant atpF can be immobilized on plates to detect anti-Brucella antibodies in serum samples

    • Optimization of coating concentration, blocking agents, and detection systems is crucial for maximizing sensitivity and specificity

    • Current research suggests combining multiple immunodominant antigens may improve diagnostic performance

  • Lateral flow assays:

    • Rapid point-of-care tests using atpF as a capture antigen

    • Balance between sensitivity and specificity must be carefully calibrated

  • Multiplex assays:

    • Inclusion of atpF alongside other immunodominant Brucella proteins in microarray formats

    • This approach may reduce cross-reactivity issues that occur in current serodiagnostic tests

Researchers should consider that while ATP synthase components are immunoreactive, they may show cross-reactivity with other bacterial species, potentially affecting specificity. Validation against diverse serum panels from confirmed cases, suspected cases, and negative controls is essential for determining true diagnostic utility.

What is the role of atpF in Brucella survival within host macrophages, and how might this inform therapeutic targets?

Although the search results don't provide specific details about atpF's role in intracellular survival, we can infer based on general principles of bacterial pathogenesis:

  • Energy metabolism during intracellular phase:

    • ATP synthase is crucial for bacterial energy production under the resource-limited conditions inside macrophages

    • Modulation of ATP production may be a survival mechanism during different infection stages

  • Adaptation to acidic phagosomal environment:

    • ATP synthase components like atpF may contribute to maintenance of proton gradient in acidified phagosomes

    • This adaptation would be critical for bacterial persistence within host cells

  • Potential as therapeutic target:

    • Inhibition of ATP synthase function through targeted compounds could compromise bacterial survival

    • Structure-based drug design focusing on unique features of bacterial ATP synthase components like atpF could yield selective antimicrobials

Comparative proteomic studies between intracellular bacteria and extracellular forms might reveal expression changes in atpF that correlate with pathogenic mechanisms .

How does post-translational modification of atpF affect its immunogenicity and function in Brucella melitensis?

Research on post-translational modifications (PTMs) of bacterial proteins has revealed their importance in pathogenesis and immune recognition. For atpF in Brucella:

  • Potential PTMs to investigate:

    • Phosphorylation sites that might regulate ATP synthase activity

    • Glycosylation patterns that could affect immunogenicity

    • Lipidation that might influence membrane integration

  • Methodological approaches:

    • Mass spectrometry-based proteomics for PTM mapping

    • Site-directed mutagenesis of modified residues

    • Functional assays comparing native and modified forms

  • Immunological significance:

    • PTMs may create unique epitopes recognized by the host immune system

    • Modified forms might elicit different antibody specificities

    • Understanding these modifications could improve vaccine and diagnostic design

While the provided search results don't specifically address PTMs of atpF, this represents an important area for further research that could enhance understanding of Brucella pathogenesis and improve intervention strategies.

What are the key controls and validation steps needed when working with recombinant atpF in immunology studies?

When designing immunology experiments with recombinant atpF, researchers should implement the following controls and validation steps:

  • Protein quality controls:

    • Endotoxin testing to ensure preparation is free from LPS contamination

    • Stability assessment under experimental conditions

    • Activity verification prior to immunological studies

  • Experimental controls:

    • Positive controls: Commercially available Brucella vaccines (e.g., Rev.1) or well-characterized immunogens

    • Negative controls: PBS, irrelevant proteins of similar size/structure

    • Technical controls: Isotype controls for antibodies, FMO controls for flow cytometry

  • Validation approaches:

    • Dose-response studies to determine optimal antigen concentration

    • Time-course experiments to establish kinetics of immune responses

    • Cross-validation using multiple assay platforms (e.g., ELISA, ELISpot, flow cytometry)

The guinea pig model described in the research on multi-epitope proteins demonstrates this approach, where PBS control and Rev.1 commercial vaccine groups were included as essential experimental controls .

What animal models are most appropriate for studying atpF-based vaccines, and what are the critical parameters to measure?

Based on the available research:

  • Suitable animal models:

    • Guinea pigs (as demonstrated in the multi-epitope protein study)

    • Mice (commonly used for initial immunogenicity studies)

    • Natural hosts: sheep, goats, cattle (for advanced vaccine candidates)

  • Critical immune parameters to measure:

    • Cytokine profiles: IFNγ and IL2 production (indicators of Th1 responses crucial for Brucella immunity)

    • Antibody responses: specific IgG titers, isotype distribution

    • Cell-mediated immunity: lymphocyte proliferation indices (PI) in response to antigen stimulation

    • Protection metrics: bacterial burden following challenge, clinical signs of disease

  • Experimental timeline considerations:

    • Prime-boost protocols with appropriate intervals

    • Long-term studies to assess duration of immunity

    • Challenge studies with virulent strains conducted in appropriate biosafety facilities

The research showed that recombinant multi-epitope protein was comparable to the Rev.1 vaccine in stimulating secretion of IFNγ and IL2, specific IgG production, and cellular proliferation, providing a benchmark for evaluating atpF-based vaccine candidates .

What analytical approaches best differentiate between the immunological responses to atpF versus other Brucella immunogens?

To effectively differentiate immune responses specific to atpF from those elicited by other Brucella proteins:

  • Advanced serological methods:

    • Competitive ELISA using monoclonal antibodies specific to atpF epitopes

    • Avidity studies to compare antibody maturation patterns

    • Epitope mapping to identify unique B-cell responses

  • T-cell response differentiation:

    • Peptide-based stimulation assays using overlapping peptides from atpF sequence

    • Intracellular cytokine staining to identify T-cell subsets responding to atpF

    • TCR repertoire analysis to characterize clonal responses

  • Systems biology approaches:

    • Transcriptomics to identify gene expression signatures specific to atpF immunization

    • Multiparameter analysis correlating various immune metrics with protection

    • Machine learning algorithms to identify patterns distinguishing atpF-specific responses

By employing these analytical techniques, researchers can build a comprehensive profile of atpF-specific immunity that distinguishes it from responses to other immunodominant Brucella proteins identified in proteomics studies, such as GroEL, GroES, DnaK, Cu-Zn SOD, and BCSP31 .

How should researchers interpret contradictory findings regarding atpF immunogenicity across different studies?

When faced with conflicting data on atpF immunogenicity:

  • Systematic comparison of methodological differences:

    • Protein preparation methods (recombinant expression systems, purification approaches)

    • Immunological assay formats (whole protein vs. peptide-based)

    • Host species and individual genetic backgrounds

    • Infection/immunization routes and dosages

  • Statistical considerations:

    • Sample size and power calculations

    • Statistical tests employed and their appropriateness

    • Effect size vs. statistical significance

    • Meta-analysis approaches where appropriate

  • Biological context factors:

    • Strain variations in atpF sequence and expression

    • Presence of cross-reactive epitopes with other ATP synthase components

    • Timing of immune response measurements relative to infection/immunization

The multiple proteomics studies cited in the search results identified different sets of immunodominant proteins depending on the experimental approach and biological samples used, highlighting the importance of methodological considerations in interpreting contradictory findings .

What bioinformatic tools and databases are most valuable for analyzing atpF sequence conservation and epitope prediction across Brucella species?

Researchers studying atpF should utilize:

  • Sequence analysis tools:

    • NCBI BLAST for basic sequence comparisons

    • Multiple sequence alignment tools (MUSCLE, Clustal Omega)

    • Phylogenetic analysis software (MEGA, RAxML) for evolutionary relationships

    • ConSurf for conservation mapping onto protein structures

  • Epitope prediction resources:

    • BepiPred, ABCpred for B-cell epitope prediction

    • NetMHC suite, IEDB for T-cell epitope prediction

    • EpiJen, SYFPEITHI for proteasomal processing prediction

    • VaxiJen for antigen prediction

  • Structural bioinformatics:

    • I-TASSER, AlphaFold for protein structure prediction

    • ZDOCK for epitope-antibody docking

    • Molecular dynamics simulation packages for epitope flexibility analysis

The successful multi-epitope approach described in the research suggests that in silico epitope prediction can be effectively utilized to design subunit vaccines with comparable efficacy to traditional vaccines like Rev.1 .

What are the statistical considerations when evaluating the diagnostic potential of atpF compared to established Brucella antigens?

When assessing atpF's diagnostic utility:

  • Performance metrics to calculate:

    • Sensitivity, specificity, positive and negative predictive values

    • Receiver operating characteristic (ROC) curves and area under curve (AUC)

    • Likelihood ratios for positive and negative test results

    • Cohen's kappa for agreement with reference tests

  • Study design considerations:

    • Case-control vs. prospective cohort approaches

    • Blinding procedures to prevent bias

    • Appropriate sample size determination based on expected performance

    • Inclusion of diverse geographical populations to account for strain variation

  • Comparative analysis framework:

    • Head-to-head comparison with established antigens (e.g., smooth LPS, BCSP31)

    • Incremental value assessment when added to existing diagnostic panels

    • Cost-effectiveness analysis considering assay complexity and reagent stability

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.