Recombinant Brucella melitensis biotype 1 Beta- (1-->2)glucan export ATP-binding/permease protein NdvA (ndvA)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

NdvA is an ATP-binding cassette (ABC) transporter protein critical for exporting β-(1→2)glucans, osmolytes that maintain bacterial cell envelope stability. In Rhodopseudomonas palustris, recombinant NdvA (UniProt ID: Q6N1Y7) is a 599-amino-acid, full-length protein fused with an N-terminal His tag, expressed in E. coli . While Brucella melitensis employs β-(1→2)cyclic glucans (CβGs) for immune evasion and intracellular survival , the specific NdvA homolog in Brucella has not been directly characterized in the provided literature.

Role in Glucan Export

NdvA in Rhodopseudomonas mediates the export of β-(1→2)glucans, which are structurally analogous to Brucella’s CβGs. These glucans:

  • Maintain osmotic balance in Gram-negative bacteria .

  • Modulate host immunity: Brucella CβGs activate dendritic cells via TLR4/MyD88/TRIF pathways, enhancing antigen-specific T-cell responses .

B. Comparative Analysis with Brucella Glucan Systems

FeatureNdvA (Rhodopseudomonas)Brucella CβG System
Export MechanismABC transporter (NdvA) Cyclic glucan synthase (Cgs)
FunctionOsmoprotection, glucan exportImmune evasion, intracellular survival
Immunological ImpactNot studiedAdjuvant properties

Brucella CβGs are synthesized by Cgs and exported via unknown mechanisms, possibly involving NdvA homologs.

Challenges and Future Directions

  1. Species-Specific Studies: No direct evidence links NdvA to Brucella glucan export. Further research is needed to identify Brucella’s ABC transporters for CβGs.

  2. Vaccine and Diagnostic Potential:

    • DIVA Candidates: Proteins like Dps (BMEI1980) in Brucella show DIVA capability , but NdvA’s role remains unexplored.

    • Adjuvant Development: Brucella CβGs enhance T-cell responses , suggesting potential for adjuvant formulations.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly include these details in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery timelines, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. You can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ndvA; BMEI0984; Beta-(1-->2glucan export ATP-binding/permease protein NdvA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-599
Protein Length
full length protein
Species
Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)
Target Names
ndvA
Target Protein Sequence
MSLLKIYWRAMQYLAVERTATITMCVASVLVALVTLAEPVLFGRVIQSISDKGDIFSPLL MWAALGGFNIMAAVFVARGADRLAHRRRLGVMIDSYERLITMPLAWHQKRGTSNALHTLI RATDSLFTLWLEFMRQHLTTVVALATLIPVAMTMDMRMSLVLIVLGVIYVMIGQLVMRKT KDGQAAVEKHHHKLFEHVSDTISNVSVVQSYNRIASETQALRDYAKNLENAQFPVLNWWA LASGLNRMASTFSMVVVLVLGAYFVTKGQMRVGDVIAFIGFAQLMIGRLDQISAFINQTV TARAKLEEFFQMEDATADRQEPENVADLNDVKGDIVFDNVTYEFPNSGQGVYDVSFEVKP GQTVAIVGPTGAGKTTLINLLQRVFDPAAGRIMIDGTDTRTVSRRSLRHAIATVFQDAGL FNRSVEDNIRVGRANATHEEVHAAAKAAAAHDFILAKSEGYDTFVGERGSQLSGGERQRL AIARAILKDSPILVLDEATSALDVETEEKLKQAVDELSHNRTTFIIAHRLSTVRSADLVL FMDKGHLVESGSFNELAERGGRFSDLLRAGGLKLEDKQPKQPVVEGSNVMPFPVKGAVA
Uniprot No.

Target Background

Function
This protein is involved in the export of beta-(1-->2)glucan. Transmembrane domains (TMD) form a pore in the inner membrane, while the ATP-binding domain (NBD) is responsible for energy generation.
Database Links
Protein Families
ABC transporter superfamily, Beta-(1-->2)glucan exporter (TC 3.A.1.108.1) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of NdvA protein in Brucella melitensis?

NdvA in Brucella melitensis functions as an ATP-binding/permease protein involved in beta-(1-->2)glucan export. Similar to its characterized counterparts in other bacteria, it contains transmembrane domains (TMD) that form a pore in the inner membrane, with an ATP-binding domain (NBD) responsible for energy generation during substrate transport . The protein belongs to the ABC transporter superfamily, specifically the Beta-(1-->2)glucan exporter family (TC 3.A.1.108.1) . In the context of Brucella pathogenicity, NdvA likely plays a crucial role in cell wall integrity and potentially in host-pathogen interactions, as cyclic beta-(1-->2)glucans are important virulence determinants in several alpha-proteobacteria.

How is NdvA expression regulated in Brucella melitensis under different environmental conditions?

The expression of NdvA in B. melitensis is regulated by environmental factors that mimic conditions encountered during infection. While specific data for NdvA regulation in B. melitensis is limited, research on similar systems in alpha-proteobacteria suggests regulation by oxygen tension, pH, osmolarity, and nutrient availability . Transcriptional regulation likely involves global transcription factors (TFs) that recognize specific motifs in the promoter region. Studies have employed both experimental and bioinformatic approaches to identify TF binding sites, with varying stringency (p-values) to confirm biological relevance . Gene expression analysis using qRT-PCR and proteomic approaches under different environmental conditions can help elucidate the regulatory network controlling NdvA expression.

What is the genetic diversity of ndvA among different Brucella melitensis isolates?

Genetic analysis of B. melitensis isolates reveals variability in the ndvA gene, with implications for evolutionary adaptation. Multi-locus variable-number tandem-repeat analysis (MLVA) has been used to assess genetic diversity among Brucella isolates . Most B. melitensis isolates (74/82) belonged to MLVA8 genotype 42, clustering in the 'East Mediterranean' group, while two B. melitensis biovar 1 isolates belonged to genotype 47 ('Americas' group) . This genetic diversity may reflect adaptations to different hosts or geographical regions. Comparative sequence analysis of ndvA from different isolates can reveal conserved regions essential for protein function versus variable regions that may contribute to strain-specific virulence properties.

What are the optimal conditions for cloning and expressing recombinant NdvA protein?

For optimal recombinant expression of NdvA protein, researchers should consider the following methodological approach:

  • Gene selection and vector design:

    • Amplify the full-length ndvA gene from B. melitensis biotype 1 genomic DNA

    • Design primers with appropriate restriction sites for directional cloning

    • Select an expression vector with a strong inducible promoter (e.g., pET system)

    • Include a purification tag (His6 or GST) preferably at the N-terminus

  • Expression optimization:

    • Test multiple E. coli strains (BL21(DE3), Rosetta, Arctic Express)

    • Optimize induction parameters: IPTG concentration (0.1-1.0 mM), temperature (16-37°C), and induction time (3-24 hours)

    • For membrane proteins like NdvA, lower temperatures (16-20°C) often improve proper folding

    • Consider using specialized systems for membrane protein expression (e.g., C43(DE3) strain)

  • Purification strategy:

    • Use detergent solubilization (DDM, LDAO, or Triton X-100) to extract the membrane-associated protein

    • Employ affinity chromatography followed by size exclusion chromatography

    • Validate protein identity by mass spectrometry and Western blotting

Recombinant DNA technology has proven effective for producing numerous Brucella proteins safely and efficiently . Previous studies have successfully cloned and expressed Brucella outer membrane proteins in E. coli, with Omp31 being the first such protein .

How can I assess the immunogenicity of recombinant NdvA protein for diagnostic applications?

To evaluate the diagnostic potential of recombinant NdvA (rNdvA), implement the following experimental design:

  • Serum panel preparation:

    • Collect sera from:

      • Bacteriologically confirmed B. melitensis-infected animals and humans

      • Vaccinated but uninfected animals

      • Healthy controls from brucellosis-free areas

      • Animals infected with cross-reactive pathogens (Yersinia, E. coli O157)

  • Immunoassay development and validation:

    • Develop indirect ELISA (i-ELISA) using purified rNdvA

    • Optimize coating concentration, blocking agent, and detection antibody dilutions

    • Compare performance with established tests (Rose Bengal, CFT, commercial ELISAs)

    • Calculate sensitivity, specificity, and agreement statistics (kappa value)

  • Cross-reactivity assessment:

    • Test against sera from animals infected with other pathogens

    • Compare with native antigens like cell envelope antigen or whole-cell sonicated antigen

What experimental approaches can be used to study NdvA-mediated beta-(1-->2)glucan export mechanisms?

To investigate NdvA-mediated beta-(1-->2)glucan export, employ these complementary approaches:

  • Genetic manipulation studies:

    • Generate ndvA knockout mutants using homologous recombination or CRISPR-Cas9

    • Create point mutations in key functional domains (Walker A/B motifs in the ATP-binding domain)

    • Develop complementation strains expressing wild-type or mutant ndvA

    • Assess changes in beta-(1-->2)glucan production and localization

  • Biochemical characterization:

    • Isolate and quantify periplasmic versus extracellular beta-(1-->2)glucans

    • Measure ATPase activity of purified NdvA using colorimetric phosphate release assays

    • Perform substrate binding assays using radiolabeled or fluorescently-tagged beta-(1-->2)glucans

    • Conduct reconstitution studies in proteoliposomes to assess transport activity

  • Structural studies:

    • Use cryo-electron microscopy to determine NdvA structure

    • Employ molecular dynamics simulations to model substrate transport

    • Perform hydrogen-deuterium exchange mass spectrometry to identify conformational changes during transport cycle

  • Host-pathogen interaction studies:

    • Evaluate the effect of ndvA mutation on bacterial survival in macrophages

    • Assess impacts on virulence in animal models

    • Determine the immunomodulatory effects of purified beta-(1-->2)glucans

These approaches should be integrated to develop a comprehensive understanding of NdvA function in Brucella pathogenesis, as has been done with other bacterial transporters in the ABC superfamily .

How do I interpret MLVA data for identifying B. melitensis biotype 1 strains?

Multi-locus variable-number tandem-repeat analysis (MLVA) has emerged as a powerful tool for Brucella molecular typing. When interpreting MLVA data for B. melitensis biotype 1 identification, follow these analytical steps:

  • Data generation and quality control:

    • Generate fragment size data for all VNTR loci (typically 16 loci in MLVA-16)

    • Convert fragment sizes to repeat unit numbers for each locus

    • Include reference strains as controls (e.g., B. melitensis 16M)

    • Verify reproducibility through duplicate testing of 10% of samples

  • Genotype assignment:

    • Analyze MLVA-8 panel first for species-level identification

    • B. melitensis biotype 1 typically clusters in specific MLVA-8 genotypes (e.g., genotype 42 in 'East Mediterranean' group or genotype 47 in 'Americas' group)

    • Analyze panel 2A and 2B loci for higher discrimination power

    • Compare with known B. melitensis biotype 1 profiles in databases

  • Cluster analysis and visualization:

    • Construct dendrograms using appropriate distance coefficients (categorical or UPGMA)

    • Generate minimum spanning trees to visualize relationships between isolates

    • Use geospatial analysis to correlate genotypes with geographical origin

    • Compare with host species data to identify host adaptation patterns

Research has shown that most B. melitensis isolates (74/82) belonged to MLVA8 genotype 42 in the 'East Mediterranean' group, while two B. melitensis biovar 1 isolates belonged to genotype 47 in the 'Americas' group . Interestingly, these genotype 47 isolates were recovered from wild animals (Himalayan blue sheep), suggesting potential wildlife reservoirs . MLVA analysis provides crucial epidemiological trace-back information and can help improve brucellosis surveillance programs .

How can I resolve contradictory results when studying NdvA function using different experimental approaches?

When facing contradictory results in NdvA functional studies, implement this systematic troubleshooting framework:

  • Experimental design analysis:

    • Evaluate differences in methodological approaches (in vitro vs. in vivo systems)

    • Assess genetic backgrounds of bacterial strains used

    • Review growth conditions and environmental factors that might influence NdvA expression

    • Consider temporal factors (growth phase, induction timing) that affect results

  • Technical validation:

    • Confirm genetic constructs through sequencing

    • Validate protein expression and localization through multiple methods (Western blot, immunofluorescence)

    • Use complementary approaches to confirm phenotypes (e.g., microscopy and biochemical assays)

    • Implement appropriate controls for each experiment

  • Statistical analysis:

    • Reassess statistical methods used and their appropriateness for the data distribution

    • Consider power analysis to ensure adequate sample sizes

    • Implement meta-analysis approaches when multiple datasets exist

    • Use Bayesian approaches to incorporate prior knowledge when appropriate

  • Integration and contextualization:

    • Develop a unified model that explains most observations

    • Identify specific conditions under which different results occur

    • Consider biological redundancy and compensatory mechanisms

    • Compare with related systems in other bacterial species

Contradictory results are not uncommon in molecular microbiology research. For example, studies on Brucella outer membrane proteins have shown differing antigenic performance depending on the experimental system and comparison standards used . These discrepancies were attributed to different methodologies for obtaining native antigens and/or conventional serological tests used as standards .

What is the potential of NdvA as a novel vaccine candidate against brucellosis?

The evaluation of NdvA as a vaccine candidate requires systematic investigation of its immunogenicity, protective efficacy, and safety profiles:

  • Immunogenicity assessment:

    • Characterize immune responses (humoral and cellular) to purified rNdvA

    • Identify immunodominant epitopes using epitope mapping techniques

    • Evaluate cross-protection potential against different Brucella species

    • Compare with established vaccine antigens like Omp31 and BP26

  • Vaccine formulation and delivery:

    • Test different adjuvant combinations (alum, oil-in-water, CpG)

    • Explore various delivery platforms (recombinant protein, DNA vaccine, viral vectors)

    • Evaluate mucosal vaccination strategies (intranasal, oral)

    • Design prime-boost regimens to enhance immunity

  • Protective efficacy:

    • Challenge studies in appropriate animal models (mice, guinea pigs, natural hosts)

    • Assess bacterial burden in target organs (spleen, liver, lymph nodes)

    • Measure cytokine profiles correlating with protection

    • Evaluate long-term immunity (6-12 months post-vaccination)

  • Safety evaluation:

    • Monitor adverse reactions in animal models

    • Assess reactogenicity and tissue reactions at injection sites

    • Conduct residue studies for food animal applications

    • Evaluate genetic stability of vaccine constructs

While no direct studies on NdvA as a vaccine candidate are available in the search results, research on other Brucella outer membrane proteins suggests potential. For instance, recombinant Omp31 has been detected by antisera in all six main Brucella species, indicating conserved epitopes . This broad recognition could be advantageous for cross-protection against multiple Brucella species and biovars.

How does NdvA contribute to Brucella survival within host cells?

The role of NdvA in intracellular survival of Brucella involves complex host-pathogen interactions:

  • Intracellular trafficking:

    • Beta-(1-->2)glucans exported by NdvA may modify Brucella-containing vacuole membranes

    • This modification potentially prevents phagolysosomal fusion

    • NdvA activity may be upregulated in response to the intracellular environment

    • Temporal expression of NdvA during different stages of intracellular life cycle

  • Immune modulation:

    • Beta-(1-->2)glucans may interact with pattern recognition receptors

    • These interactions could dampen pro-inflammatory responses

    • Potential interference with antigen presentation pathways

    • Modulation of autophagy mechanisms in host cells

  • Adaptation to intracellular stresses:

    • NdvA-exported glucans may provide osmotic protection

    • Protection against oxidative and nitrosative stress

    • Contribution to membrane integrity under stress conditions

    • Potential role in biofilm formation within host cells

  • Metabolic adaptation:

    • Integration with other virulence systems through regulatory networks

    • Coordination with type IV secretion systems for efficient intracellular survival

    • Potential role in nutrient acquisition from host cells

    • Adaptation to the nutrient-limited intracellular environment

Understanding these mechanisms requires integrated approaches combining bacterial genetics, host cell biology, and advanced imaging techniques. While the search results don't provide direct evidence for NdvA's role in intracellular survival, the importance of bacterial transporters in pathogenesis is well established, and the ABC transporter superfamily to which NdvA belongs is known to play crucial roles in bacterial virulence .

How can systems biology approaches enhance our understanding of NdvA function in the context of Brucella pathogenesis?

Systems biology offers powerful frameworks to understand the complex role of NdvA in Brucella pathogenesis:

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Compare wild-type and ndvA mutant strains under various conditions

    • Identify co-regulated genes and proteins in the NdvA network

    • Map metabolic changes associated with beta-(1-->2)glucan export

  • Network analysis:

    • Construct gene regulatory networks centered on NdvA

    • Identify transcription factors controlling ndvA expression

    • Map protein-protein interaction networks involving NdvA

    • Integrate with host response networks during infection

  • Predictive modeling:

    • Develop mathematical models of beta-(1-->2)glucan export kinetics

    • Create agent-based models of host-pathogen interactions

    • Perform in silico mutation analysis to predict phenotypes

    • Model evolution of NdvA across Brucella species and strains

  • Experimental validation:

    • Test predictions using targeted genetic and biochemical approaches

    • Validate computational models with experimental data

    • Refine models iteratively based on new experimental results

    • Apply findings to develop intervention strategies

Systems biology approaches have been applied to understand symbiotic nitrogen fixation regulatory networks in related alpha-proteobacteria . These studies identified 95 operons with potential NifA-binding sites comprising 280 genes in Alphaproteobacteria . Similar approaches could elucidate the regulatory networks involving NdvA in Brucella. The RhizoBindingSites database contains conserved motifs represented in matrices per gene with different significance levels, which could inform analysis of ndvA regulation .

What are the most effective methods for studying NdvA protein-protein interactions in Brucella?

To investigate NdvA protein-protein interactions, employ these complementary methodologies:

  • Affinity-based approaches:

    • Co-immunoprecipitation with anti-NdvA antibodies

    • Tandem affinity purification using tagged NdvA

    • Pull-down assays with purified recombinant NdvA

    • Proximity-dependent biotin identification (BioID) in live bacteria

  • Genetic interaction screening:

    • Bacterial two-hybrid system adapted for membrane proteins

    • Suppressor mutation analysis to identify functional partners

    • Synthetic genetic array analysis to map genetic interactions

    • CRISPR interference screening to identify functional dependencies

  • Structural biology methods:

    • Crosslinking mass spectrometry to capture transient interactions

    • Single-particle cryo-EM of NdvA complexes

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

    • Förster resonance energy transfer (FRET) to study dynamics in live cells

  • Computational prediction and validation:

    • Homology-based interactome prediction

    • Molecular docking simulations

    • Coevolution analysis to identify potential partners

    • Network inference from multi-omics data

Protein interaction studies have revealed complex networks in related bacteria. For example, the symbiosis interactome of Sinorhizobium meliloti with its host plants was predicted to comprise 440 proteins involved in 1041 unique interactions . Similar approaches could elucidate the NdvA interactome in Brucella melitensis, providing insights into its functional context within bacterial physiology and pathogenesis.

How can CRISPR-Cas9 technology be optimized for studying NdvA function in Brucella melitensis?

Optimizing CRISPR-Cas9 for studying NdvA in Brucella requires addressing several technical challenges:

  • Delivery system optimization:

    • Electroporation protocols adapted for Brucella (field strength, buffer composition)

    • Conjugation-based delivery from donor E. coli strains

    • Phage-based delivery systems if applicable

    • Selection of appropriate plasmid backbones (copy number, stability)

  • CRISPR-Cas9 component optimization:

    • Codon optimization of Cas9 for Brucella expression

    • Testing different promoters for optimal Cas9 expression

    • Evaluation of various sgRNA scaffold designs

    • Comparison of Cas9 variants (high-fidelity, nickase, catalytically dead)

  • Targeting strategy:

    • Design of multiple sgRNAs targeting different regions of ndvA

    • Bioinformatic analysis to minimize off-target effects

    • Development of strategies for precise gene editing (point mutations, domain deletions)

    • Creation of conditional knockdown systems using CRISPRi

  • Verification and validation:

    • Sequencing-based verification of edits

    • Phenotypic characterization of mutants

    • Complementation studies to confirm specificity

    • Whole-genome sequencing to assess off-target modifications

  • Experimental protocol:

    • Prepare CRISPR-Cas9 components:

      • Clone sgRNAs targeting ndvA into a suitable vector

      • Optimize Cas9 expression under an inducible promoter

      • Design repair templates for desired modifications

    • Transform Brucella cells with the CRISPR-Cas9 system

    • Select transformants and screen for desired modifications

    • Validate edits by sequencing and functional assays

While CRISPR-Cas9 has revolutionized bacterial genetics, its application in Brucella requires careful optimization. The methodology must be tailored to overcome challenges specific to this organism, such as its intracellular lifestyle and biosafety considerations.

This systematic approach will enable precise genetic manipulation of ndvA, facilitating detailed functional studies of this important transport protein in Brucella pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.