Recombinant Brucella melitensis biotype 1 Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Functional Role in Brucella Pathogenesis

plsY is a key enzyme in the bacterial glycerolipid biosynthesis pathway, facilitating membrane phospholipid production. Genome analyses of B. melitensis reveal:

  • Glycerol Metabolism: B. melitensis lacks glycerol uptake facilitators but retains glycerol kinase and glycerol-3-phosphate dehydrogenase, suggesting reliance on host-derived glycerol .

  • Pathogenic Adaptation: The enzyme’s role in membrane synthesis supports bacterial survival within host cells, particularly during intracellular replication .

  • Regulatory Networks: While not directly studied, plsY’s activity aligns with Brucella’s adaptive metabolic shifts during infection, including gluconeogenesis and lipid utilization .

Diagnostic Tools

Recombinant plsY is used in ELISA kits to detect anti-Brucella antibodies, leveraging its immunogenic properties. Key features:

  • Immunogenicity: Recognized as a potential antigen in serological assays due to its conserved sequence across Brucella species .

  • Cross-Reactivity: Homology with B. suis plsY (A9WYS0) suggests utility in broader brucellosis diagnostics .

Vaccine Development

While not directly tested, plsY’s role in membrane synthesis positions it as a candidate for subunit vaccines, similar to other Brucella membrane proteins (e.g., Omp10, Omp28) .

Production and Expression Systems

Recombinant plsY is produced via bacterial expression systems:

SystemDetails
E. coliHigh-yield expression; His-tag enables nickel affinity chromatography
Pichia pastorisNot reported for plsY, but used for other Brucella antigens (e.g., Omp10-Omp28-L7/L12)

Research Findings and Gaps

  • Gene Expression: plsY is not explicitly mentioned in B. melitensis transcriptomic studies, but glycerolipid synthesis genes are upregulated during invasive growth phases .

  • Resistance Mechanisms: Brucella’s adaptive resistance to rifampicin involves rpoB mutations and VirB secretion systems, but plsY’s role in antibiotic evasion remains unexplored .

  • Structural Insights: No crystallographic data exists for plsY, limiting mechanistic studies.

Comparative Analysis with Brucella suis plsY

Recombinant B. suis plsY (A9WYS0) shares structural and functional similarities with B. melitensis plsY:

AspectB. melitensis plsY (Q8YC64)B. suis plsY (A9WYS0)
Length201 aa201 aa
Sequence Identity~95% with B. suis
Expression HostE. coliE. coli
TagHis (N-terminal)His (N-terminal)

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
plsY; BMEII0668; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)
Target Names
plsY
Target Protein Sequence
MAEPGFFNAMLIGALIFGYVLGSIPFGLILTRLAGLGDVRAIGSGNIGATNVLRTGNKKL AAATLILDALKGTAAALIAAHFGQNAAIAAGFGAFIGHLFPVWIGFKGGKGVATYLGVLI GLAWAGALVFAAAWIVTALLARYSSLSALVASLVVPIALYSRGNQALAALFAIMTVIVFI KHRANISRLLNGTESKIGAKG
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as the fatty acyl donor but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of Glycerol-3-phosphate acyltransferase (plsY) in Brucella melitensis?

Glycerol-3-phosphate acyltransferase (plsY) is an integral membrane protein that plays a crucial role in the initiation of phospholipid biosynthesis in Brucella melitensis. The enzyme catalyzes the transfer of acyl groups from acylphosphate to glycerol-3-phosphate, representing a critical step in membrane phospholipid biosynthesis. This pathway involves the conversion of acyl-acyl carrier protein to acylphosphate by PlsX, followed by the transfer of the acyl group to glycerol-3-phosphate by PlsY to form lysophosphatidic acid, which is a precursor for membrane phospholipid formation. This process is essential for bacterial membrane integrity, making plsY a potential target for antimicrobial development and vaccine research .

What is the structural organization of Brucella melitensis plsY protein?

The Brucella melitensis plsY protein, similar to its homologs in other bacteria, is predicted to be an integral membrane protein with a complex structural organization. Based on studies of PlsY from other bacterial species such as Streptococcus pneumoniae, the protein likely possesses five membrane-spanning segments. The amino terminus and two short loops are positioned on the external face of the membrane, while three larger cytoplasmic domains contain highly conserved sequence motifs essential for catalytic activity. These conserved motifs include: Motif 1, containing essential serine and arginine residues; Motif 2, exhibiting characteristics of a phosphate-binding loop and serving as the glycerol-3-phosphate binding site; and Motif 3, containing a conserved histidine and asparagine important for activity and a glutamate critical for structural integrity .

How is recombinant Brucella melitensis plsY properly stored and handled in laboratory settings?

Recombinant Brucella melitensis plsY requires specific storage conditions to maintain its structural integrity and enzymatic activity. The optimal storage conditions include keeping the protein at -20°C for regular use, or at -80°C for extended storage periods. The protein is typically maintained in a Tris-based buffer containing 50% glycerol, which is specifically optimized to preserve protein stability. To prevent protein degradation, repeated freezing and thawing cycles should be strictly avoided. For ongoing experiments, working aliquots can be stored at 4°C for up to one week to minimize freeze-thaw cycles. These handling protocols are essential for maintaining protein functionality in experimental settings and ensuring reproducible research outcomes .

How does plsY contribute to Brucella melitensis virulence and survival in host tissues?

The plsY gene plays a significant role in Brucella melitensis virulence and survival within host tissues, particularly in different microenvironments encountered during infection. Genome-wide analysis using transposon sequencing has identified organ-specific requirements for B. melitensis multiplication. Research has shown that B. melitensis requires different sets of genes for survival depending on the host tissue environment, with 257 genes essential for multiplication in the spleen and 135 genes required in the lungs, with 87 genes common to both environments. Although plsY itself was not specifically highlighted in the search results, the related phospholipid biosynthesis gene plsC has been found to be important for virulence, as deletion mutants of plsC showed attenuation in the spleen while maintaining immunogenicity .

The importance of plsY likely stems from its role in bacterial membrane phospholipid biosynthesis, which is crucial for maintaining membrane integrity under the stressful conditions encountered in host tissues, including acidic environments within the Brucella-containing vacuole (BCV). The acidification of the BCV is essential for Brucella survival within host cells, suggesting that genes involved in adapting to acidic conditions, potentially including plsY, are critical virulence determinants. Transcriptomic analyses comparing virulent and attenuated strains under acidic conditions provide insights into genes that may contribute to intracellular survival mechanisms .

What methodologies are most effective for analyzing plsY enzyme activity and substrate specificity?

For comprehensive analysis of plsY enzyme activity and substrate specificity, researchers should employ a multi-methodological approach combining both in vitro biochemical assays and in vivo functional studies. The substituted cysteine accessibility method (SCAM) has proven effective for determining membrane topology of plsY, as demonstrated in studies with Streptococcus pneumoniae PlsY. This technique helps identify membrane-spanning segments and the orientation of protein domains relative to the membrane, which is crucial for understanding structure-function relationships .

For enzymatic characterization, a recommended methodology includes:

  • In vitro acyltransferase assays: Utilizing radiolabeled substrates or fluorescent analogs to measure the transfer of acyl groups from acylphosphate to glycerol-3-phosphate.

  • Site-directed mutagenesis: Targeting conserved motifs to identify critical residues for catalysis. For example, mutations in the conserved glycines in motif 2 to alanines resulted in a Km defect for glycerol-3-phosphate binding in S. pneumoniae PlsY .

  • Inhibition studies: Testing competitive and non-competitive inhibitors, such as palmitoyl-CoA which has been shown to non-competitively inhibit PlsY activity .

  • Kinetic analysis: Determining Km and Vmax values for different substrates to assess substrate preferences.

The following table summarizes key methodological approaches for plsY characterization:

MethodologyApplicationKey ParametersExpected Outcomes
SCAMMembrane topologyAccessibility of substituted cysteinesIdentification of membrane-spanning segments
Site-directed mutagenesisFunctional analysisActivity of mutant proteinsIdentification of critical catalytic residues
In vitro acyltransferase assaysEnzymatic activityReaction rates with various substratesSubstrate specificity profiles
Inhibition studiesInhibitor screeningKi values, inhibition mechanismsPotential antimicrobial compounds
RNA-seq analysisGene expressionDifferential expression under stressRegulatory patterns in pathogenesis

How does plsY expression in Brucella melitensis change under acidic conditions relevant to intracellular survival?

The expression patterns of genes in Brucella melitensis under acidic conditions provide critical insights into adaptation mechanisms for intracellular survival. Comparative transcriptomic analyses between the virulent 16M strain and the attenuated Rev.1 vaccine strain revealed 403 genes that respond differently to acidic conditions between the two strains (FDR < 0.05, fold change ≥ 2). These differentially expressed genes are involved in crucial cellular processes, including metabolic, biosynthetic, and transport processes .

Although the search results don't specifically mention plsY expression patterns under acidic conditions, the biological context suggests that genes involved in membrane biosynthesis and integrity, like plsY, would likely show altered expression in acidic environments. The acidification of the Brucella-containing vacuole (BCV) is essential for the survival of the pathogen, indicating that genes contributing to adaptation to acidic environments are crucial for virulence .

Research methodologies to investigate plsY expression under acidic conditions should include:

  • RNA-seq analysis: Comparing plsY transcript levels between normal and acidic pH conditions, and between virulent and attenuated strains.

  • Quantitative RT-PCR: Validating RNA-seq findings with targeted gene expression analysis.

  • Reporter gene assays: Using plsY promoter fusions to reporter genes to monitor expression in different conditions.

  • Proteomics: Comparing PlsY protein levels under different pH conditions to identify post-transcriptional regulation.

Such studies would contribute to understanding how Brucella modulates its membrane composition through plsY regulation to adapt to the acidic intracellular environment.

What are the implications of plsY mutations for Brucella vaccine development?

Mutations in genes involved in phospholipid biosynthesis, including those in the plsY pathway, have significant implications for Brucella vaccine development. Recent research on phospholipid biosynthesis genes, particularly plsC, has shown promising results for vaccine development. A deletion mutant for the plsC gene demonstrated protective efficacy similar to that of the reference Rev.1 vaccine but with shorter persistence in the spleen, addressing a key concern with live attenuated vaccines .

While plsY-specific mutations were not directly discussed in the search results, the related phospholipid biosynthesis pathway presents a valuable target for rational vaccine design. The ideal characteristics for a live attenuated vaccine (LAV) include:

  • Controlled virulence at the tissue level: Ensuring sufficient immunogenicity while preventing long-term persistence.

  • Organ-specific attenuation: Targeting genes essential for multiplication in reservoir organs like the spleen while maintaining initial immunostimulatory capacity.

  • Preservation of protective antigens: Ensuring that attenuation does not compromise the expression of key immunogens.

Mutations in plsY could potentially achieve these characteristics by:

  • Disrupting membrane phospholipid composition sufficiently to attenuate virulence

  • Maintaining enough metabolic activity to express immunoprotective antigens

  • Potentially resulting in strain-specific attenuation in certain tissues

The development of genome-wide functional maps of bacterial virulence genes according to host organs, as demonstrated with transposon sequencing approaches, provides a rational framework for identifying candidate genes like plsY for targeted mutations in vaccine development .

How does the plsY protein in Brucella melitensis interact with other components of the phospholipid biosynthesis pathway?

The plsY protein in Brucella melitensis functions within a complex phospholipid biosynthesis network, interacting with multiple pathway components to facilitate membrane biogenesis. In the most widely distributed bacterial phospholipid biosynthesis pathway, plsY works in conjunction with PlsX, which converts acyl-acyl carrier protein to acylphosphate. PlsY then catalyzes the transfer of the acyl group from acylphosphate to glycerol-3-phosphate, forming lysophosphatidic acid, which serves as a substrate for subsequent enzymes in the pathway .

The interaction network involves:

  • PlsX: Provides the acylphosphate substrate for PlsY in a coordinated two-step process.

  • Acyl carrier protein (ACP): Interacts indirectly with PlsY through the PlsX-mediated conversion of acyl-ACP to acylphosphate.

  • PlsC: Functions downstream of PlsY, converting the lysophosphatidic acid produced by PlsY to phosphatidic acid through acylation at the sn-2 position.

  • Membrane phospholipid synthesis enzymes: Further modify phosphatidic acid to produce various membrane phospholipids.

Methodologies to study these interactions include:

  • Protein-protein interaction studies: Co-immunoprecipitation, bacterial two-hybrid systems, or proximity labeling techniques to identify direct interaction partners.

  • Metabolic labeling: Tracking the flow of labeled precursors through the pathway to identify rate-limiting steps and metabolic dependencies.

  • Lipidomic analysis: Characterizing changes in membrane lipid composition in response to perturbations in plsY activity.

  • In vitro reconstitution: Assembling purified components to reconstruct pathway sections and measure coupled enzymatic activities.

Understanding these interactions is crucial for developing targeted approaches to disrupt bacterial membrane synthesis for both antimicrobial development and rational vaccine design.

What are the optimal conditions for expressing and purifying recombinant Brucella melitensis plsY?

The optimal expression and purification of recombinant Brucella melitensis plsY requires careful consideration of several factors due to its nature as an integral membrane protein. Based on general principles for membrane protein purification and the specific information available about plsY, the following optimized protocol is recommended:

Expression System Selection:

  • E. coli BL21(DE3) or C43(DE3) strains are recommended for membrane protein expression.

  • Consider using a vector with a tightly controlled inducible promoter (such as pET series with T7 promoter).

  • Fusion tags should be determined during the production process to optimize protein folding and solubility .

Expression Conditions:

  • Lower induction temperatures (16-25°C) are typically more suitable for membrane proteins to promote proper folding.

  • Reduced inducer concentration and extended expression times (overnight) may improve yield of functional protein.

  • Rich media supplemented with glycerol can enhance membrane protein expression.

Membrane Protein Extraction:

  • Gentle cell lysis methods using enzymatic approaches (lysozyme treatment) combined with mechanical disruption.

  • Careful selection of detergents for solubilization (e.g., n-dodecyl-β-D-maltoside, CHAPS, or digitonin) is critical for maintaining native structure.

Purification Strategy:

  • Affinity chromatography using the fusion tag determined during production.

  • Size exclusion chromatography for further purification and assessment of oligomeric state.

  • Ion exchange chromatography as a polishing step if needed.

Storage Conditions:

  • The purified protein should be maintained in Tris-based buffer with 50% glycerol.

  • For extended storage, store at -20°C or -80°C.

  • Avoid repeated freeze-thaw cycles and prepare working aliquots for short-term use at 4°C (up to one week) .

How can researchers effectively design and implement plsY knockout or mutation studies in Brucella melitensis?

Designing and implementing effective plsY knockout or mutation studies in Brucella melitensis requires strategic approaches due to the essential nature of phospholipid biosynthesis genes. The following comprehensive methodology is recommended based on established practices in Brucella genetics and the specific characteristics of plsY:

1. Strategic Mutation Design:

  • Conditional knockouts: Implement inducible promoter systems (such as tetracycline-responsive elements) to control plsY expression, allowing viable bacteria for initial studies while enabling expression shutdown during experiments.

  • Domain-specific mutations: Target conserved motifs identified in PlsY homologs, such as the three critical motifs found in Streptococcus pneumoniae PlsY: Motif 1 (containing essential serine and arginine), Motif 2 (glycerol-3-phosphate binding site), and Motif 3 (containing conserved histidine, asparagine, and glutamate) .

  • Site-directed mutagenesis: Create point mutations that retain partial function while compromising activity in specific environments, especially targeting residues that might affect adaptation to acidic conditions.

2. Genetic Manipulation Techniques:

  • Allelic exchange: Use suicide plasmids containing the mutated plsY gene flanked by homologous regions for double crossover recombination.

  • CRISPR-Cas9 systems: Optimize CRISPR-based approaches for precise genomic editing in Brucella, which may require adaptation of protocols developed for other bacteria.

  • Transposon mutagenesis: For initial screening, use transposon libraries to identify viable insertion sites in plsY that maintain partial function.

3. Phenotypic Analysis Framework:

  • Growth curve analysis: Compare growth rates under standard and stress conditions (acidic pH, nutrient limitation, oxidative stress).

  • Membrane integrity assays: Assess changes in membrane permeability and composition using fluorescent dyes and lipidomic analysis.

  • Intracellular survival assays: Quantify bacterial persistence in cellular infection models (macrophages, epithelial cells) at different time points.

  • Animal infection models: Evaluate attenuation in mouse models, focusing on bacterial burden in spleen and lungs over time .

  • Transcriptomic profiling: Compare gene expression patterns between wild-type and mutant strains under normal and stress conditions .

4. Practical Considerations:

  • Biosafety measures must adhere to containment level requirements for Brucella work.

  • Incorporate appropriate antibiotic resistance markers that don't interfere with experimental outcomes.

  • Include complementation studies to confirm phenotypic changes are directly attributable to plsY mutations.

  • Design time-course experiments to capture both immediate and adaptive responses to plsY perturbation.

This comprehensive approach enables researchers to systematically investigate plsY function while developing potential vaccine candidates with targeted attenuation profiles.

What advanced analytical techniques can be used to characterize the structural dynamics of plsY during substrate binding?

Advanced analytical techniques for characterizing the structural dynamics of plsY during substrate binding require specialized approaches due to its nature as a membrane protein. The following methodological framework provides comprehensive insights into the protein's conformational changes and substrate interactions:

1. High-Resolution Structural Analysis:

  • Cryo-electron microscopy (cryo-EM): Particularly valuable for membrane proteins, cryo-EM can capture different conformational states of plsY in near-native environments without crystallization. Sample preparation would involve reconstitution in nanodiscs or detergent micelles.

  • X-ray crystallography: While challenging for membrane proteins, this technique can provide atomic-resolution structures if suitable crystals can be obtained. Co-crystallization with substrates or substrate analogs can capture binding-induced conformational changes.

  • NMR spectroscopy: Solution NMR of selectively labeled plsY can provide dynamics information, especially for loop regions and substrate binding sites. Solid-state NMR is particularly suitable for membrane proteins in lipid environments.

2. Dynamics and Interaction Studies:

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can map regions of conformational change upon substrate binding by measuring the rate of hydrogen-deuterium exchange in different protein segments.

  • Single-molecule FRET (smFRET): By labeling specific residues with fluorescent pairs, researchers can monitor distance changes during substrate binding events, providing insights into conformational dynamics.

  • Molecular dynamics (MD) simulations: Computational approaches can model plsY in membrane environments, predicting conformational changes upon substrate binding and identifying key interaction residues.

3. Functional and Binding Analyses:

  • Isothermal titration calorimetry (ITC): Measures the thermodynamic parameters of substrate binding, providing binding affinities, stoichiometry, and enthalpy changes.

  • Surface plasmon resonance (SPR): Can determine binding kinetics (kon/koff) for substrates and potential inhibitors when plsY is immobilized on sensor chips.

  • Fluorescence-based assays: Using environment-sensitive fluorescent probes or labeled substrates to monitor binding events and conformational changes in real-time.

4. Integrated Structural Biology Approach:

The most comprehensive characterization would integrate data from multiple techniques in an iterative process:

  • Generate initial structural models using cryo-EM or X-ray crystallography

  • Identify dynamic regions and substrate interactions using HDX-MS and NMR

  • Refine models with computational approaches guided by experimental constraints

  • Validate functional predictions through mutagenesis and activity assays

  • Characterize the energetics and kinetics of substrate binding

This multi-technique approach can overcome the limitations of individual methods and provide a comprehensive understanding of plsY structural dynamics during its catalytic cycle, informing both fundamental mechanistic insights and structure-based drug design efforts.

How does plsY function compare between Brucella melitensis and other pathogenic bacteria?

Glycerol-3-phosphate acyltransferase (plsY) function exhibits notable conservation across pathogenic bacteria while displaying species-specific adaptations that reflect evolutionary pressures and ecological niches. Comparative analysis reveals several key similarities and differences between Brucella melitensis plsY and its homologs in other pathogens:

Conserved Structural Features:
The fundamental topology of plsY appears consistent across bacterial species, with the Streptococcus pneumoniae plsY serving as a well-characterized model. This protein possesses five membrane-spanning segments with three major cytoplasmic domains containing highly conserved sequence motifs essential for catalysis . The Brucella melitensis plsY likely shares this basic architecture, reflecting the fundamental conservation of this critical enzyme in phospholipid biosynthesis.

Catalytic Mechanism Similarities:
The core catalytic function—transferring acyl groups from acylphosphate to glycerol-3-phosphate—remains constant across bacterial species. Critical active site residues are highly conserved, including:

  • Motif 1: Essential serine and arginine residues

  • Motif 2: Glycine-rich phosphate-binding loop that interacts with glycerol-3-phosphate

  • Motif 3: Conserved histidine and asparagine important for activity

Species-Specific Adaptations:
Despite these conserved elements, differences exist that likely reflect adaptation to specific lifestyles:

  • Intracellular pathogens vs. extracellular pathogens: Brucella melitensis, as an intracellular pathogen, likely has adaptations in plsY that facilitate survival in the acidified Brucella-containing vacuole environment. This contrasts with extracellular pathogens like S. pneumoniae.

  • Substrate preference variations: Different bacterial species may show variations in acyl chain length preferences that reflect the typical membrane composition required for their ecological niche.

  • Regulatory mechanisms: The control of plsY expression likely varies across species, with intracellular pathogens like Brucella potentially showing more complex regulation in response to host-derived signals.

  • Integration with metabolic networks: How plsY interfaces with other metabolic pathways may differ, particularly in terms of coordinating membrane biogenesis with cell division and stress responses.

The differences in plsY function across bacterial species provide valuable insights for both fundamental understanding of bacterial adaptation and for the development of species-specific antimicrobial strategies that target this essential enzyme.

What are the most promising approaches for developing inhibitors targeting Brucella melitensis plsY?

The development of inhibitors targeting Brucella melitensis plsY represents a promising avenue for novel therapeutic interventions against brucellosis. Based on the current understanding of plsY structure and function, several strategic approaches show particular promise:

1. Structure-Based Drug Design:
Utilizing the structural information available for plsY homologs, particularly the identified conserved motifs crucial for catalysis, researchers can implement rational design strategies targeting:

  • Active site inhibitors: Compounds designed to competitively bind the glycerol-3-phosphate binding site (Motif 2) or mimic the acylphosphate substrate.

  • Allosteric inhibitors: Molecules that bind to non-catalytic regions but induce conformational changes that compromise enzyme function.

  • Covalent inhibitors: Compounds that form irreversible bonds with critical residues like the essential serine in Motif 1 .

2. Substrate Analog Development:
The natural substrates of plsY provide templates for designing competitive inhibitors:

  • Acylphosphate mimetics: Stable analogs that bind but resist catalysis.

  • Modified glycerol-3-phosphate derivatives: Compounds with structural modifications that enable binding but prevent product formation.

  • Transition state analogs: Molecules that mimic the structure of the reaction's transition state, typically binding with higher affinity than substrates.

3. High-Throughput Screening Approaches:
Implementation of screening campaigns using:

  • In vitro enzymatic assays: Measuring inhibition of recombinant plsY activity.

  • Whole-cell antibacterial screens: Identifying compounds with activity against Brucella with subsequent target validation.

  • Fragment-based screening: Building inhibitors from small molecular fragments that bind to different regions of the protein.

4. Comparative Inhibition Strategy:
Leveraging known inhibitors of plsY from other bacterial systems:

  • Palmitoyl-CoA derivatives: Based on the observation that palmitoyl-CoA noncompetitively inhibits plsY .

  • Cross-species inhibitor optimization: Adapting effective inhibitors from related enzymes with adjustments for Brucella-specific features.

5. Consideration of Membrane Environment:
As plsY is an integral membrane protein, successful inhibitor development must account for:

  • Lipophilicity and membrane permeability: Ensuring inhibitors can access the target embedded in bacterial membranes.

  • Selectivity for bacterial vs. host membranes: Developing compounds that preferentially partition into bacterial rather than eukaryotic membranes.

  • Computational modeling of membrane-protein-inhibitor interactions: Using advanced simulation techniques to predict inhibitor binding in the native membrane environment.

The most promising inhibitor development programs would integrate these approaches while considering the unique challenges presented by Brucella as an intracellular pathogen, particularly the need for compounds to penetrate both host cell and bacterial membranes to reach their target.

What emerging technologies could advance our understanding of plsY's role in Brucella pathogenesis?

The investigation of plsY's role in Brucella pathogenesis stands to benefit significantly from several emerging technologies that offer unprecedented precision, throughput, and insight into bacterial processes during infection. These innovative approaches will likely transform our understanding of this critical enzyme:

1. Advanced Genetic Manipulation Systems:

  • CRISPR interference (CRISPRi): Enables tunable repression of plsY expression without genetic deletion, allowing temporal control during different infection stages.

  • Base editing technologies: Permit precise single nucleotide changes without double-strand breaks, facilitating subtle alterations to plsY structure to dissect functional domains.

  • Inducible degradation systems: Tools like auxin-inducible degrons adapted for bacterial systems could allow rapid depletion of PlsY protein at specific infection timepoints.

2. Single-Cell and Spatial Technologies:

  • Single-cell RNA-seq of infected host cells: Reveals heterogeneity in bacterial gene expression, including plsY, within different intracellular microenvironments.

  • Spatial transcriptomics: Maps plsY expression patterns within infected tissues, correlating with specific histopathological features.

  • Advanced microscopy techniques: Super-resolution approaches combined with specific probes can visualize PlsY localization relative to host cell compartments during infection.

3. Host-Pathogen Interaction Analysis:

  • Interspecies CRISPR screens: Simultaneous perturbation of bacterial (including plsY) and host genes to map genetic interactions during infection.

  • Proximity labeling proteomics: Identification of host proteins that interact with PlsY during different stages of intracellular trafficking.

  • Organoid infection models: More physiologically relevant systems to study PlsY function during infection of structured, differentiated host tissues.

4. Multi-omics Integration:

  • Systems biology approaches: Integration of transcriptomics, proteomics, metabolomics, and lipidomics data to place PlsY in the context of global bacterial adaptation to intracellular environments.

  • Fluxomics: Tracing metabolic flux through phospholipid biosynthesis pathways under different infection conditions.

  • Computational modeling: Predicting the effects of PlsY perturbation on bacterial membrane composition and integrity during infection.

5. In vivo Technologies:

  • Intravital microscopy: Real-time visualization of fluorescently tagged Brucella with wild-type or modified plsY during infection in living animals.

  • In vivo CRISPR screening: Identification of genetic interactions with plsY that affect bacterial fitness during infection.

  • In-host evolution experiments: Tracking adaptive mutations in plsY during long-term infection to identify selective pressures.

The integration of these emerging technologies would provide a comprehensive understanding of plsY's role throughout the Brucella infection cycle, from initial entry to persistence in reservoir organs like the spleen . This knowledge would not only advance fundamental understanding of bacterial pathogenesis but also inform the development of more effective vaccines and targeted therapeutics.

How might comparative genomics and evolutionary analysis of plsY inform Brucella vaccine development strategies?

Comparative genomics and evolutionary analysis of plsY across Brucella species and strains offers valuable insights for rational vaccine development strategies. This approach can identify conserved and variable features of plsY that influence virulence, host adaptation, and immunogenicity—all critical factors for designing effective vaccines:

1. Identification of Conserved Functional Domains:
Evolutionary analysis of plsY sequences across Brucella species can reveal highly conserved regions that likely serve essential functions that cannot be readily mutated without compromising bacterial viability. These regions represent:

  • Potential targets for attenuation: Strategic mutations in conserved residues might generate viable but attenuated strains suitable for live vaccines.

  • Cross-species protective antigens: Conserved epitopes might elicit protection against multiple Brucella species.

  • Functionally constrained sites: Positions where mutations are likely to have predictable effects on enzyme function based on evolutionary conservation.

2. Detection of Host-Adaptive Signatures:
Comparative genomics can reveal host-specific adaptations in plsY across Brucella species that infect different animal hosts (B. melitensis in small ruminants versus B. abortus in cattle, for example):

  • Selection pressure analysis: Identification of positively selected residues in plsY that may contribute to host adaptation.

  • Host-specific functional variants: Discovery of plsY variants that optimize function in particular host environments.

  • Pathogenicity islands: Context of plsY within genomic regions that show evidence of horizontal transfer or host adaptation.

3. Vaccine Strain Optimization Framework:
Evolutionary insights can guide rational plsY modifications for vaccine development:

  • Ancestral sequence reconstruction: Design of plsY variants based on inferred ancestral sequences that maintain essential function but lack specialized virulence adaptations.

  • Chimeric designs: Creation of hybrid plsY sequences combining features from different strains to achieve optimal attenuation while maintaining immunogenicity.

  • Strategic mutation selection: Identification of sites where mutations would maximally impact virulence while minimally affecting protective antigen presentation.

4. Correlation with Existing Vaccine Strains:
Analysis of plsY sequences in naturally attenuated strains and successful vaccines like Rev.1:

  • Attenuation signatures: Identification of naturally occurring plsY variations that correlate with reduced virulence but maintained immunogenicity.

  • Compensatory mutation patterns: Understanding how the bacterial genome compensates for plsY mutations to maintain viability.

  • Stability analysis: Assessment of the evolutionary stability of attenuating mutations in plsY to predict vaccine strain stability.

5. Integration with Virulence Mapping:
Combining evolutionary analysis with functional genomics data from transposon sequencing studies:

  • Organ-specific essentiality patterns: Correlation between evolutionary conservation and the requirement for plsY in different host tissues .

  • Virulence factor interactions: Identification of co-evolving genes that functionally interact with plsY and might influence vaccine efficacy.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.