Recombinant Brucella melitensis biotype 1 Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Brucella melitensis Biotype 1 Large-Conductance Mechanosensitive Channel (mscL)

The Recombinant Brucella melitensis biotype 1 Large-conductance mechanosensitive channel (mscL) is a cloned and expressed version of the native mscL protein from Brucella melitensis, a pathogenic bacterium causing brucellosis. This recombinant protein is engineered for research and therapeutic applications, often produced in E. coli with added tags (e.g., His-tag) for purification .

Mechanistic Studies

  • Gating Mechanism: mscl opens via a "membrane-mediated" mechanism, where lateral tension tilts M1 helices, expanding the pore . Computational studies (e.g., molecular dynamics simulations) have modeled this process, revealing asymmetric expansion and TM1 bending during activation .

  • Modulation Strategies: Small molecules (e.g., 011A, K05) stabilize open states by binding hydrophobic residues (I34, L36, L40) in TM1 . These insights aid antimicrobial drug design targeting Brucella and other Gram-negative bacteria .

Therapeutic Potential

  • Antimicrobial Targets: mscl’s absence in eukaryotes makes it a candidate for bactericidal agents. Modulators like IRS-16 and SCH-79797 disrupt membrane integrity by stabilizing open channels .

  • Cancer Therapy: Activated mscl expressed in mitochondrial membranes induces apoptosis in cancer cells (e.g., A549), synergizing with ultrasound therapy .

Diagnostic and Proteomic Tools

  • ELISA Kits: Recombinant mscL is used in immunoassays to detect anti-Brucella antibodies, aiding brucellosis diagnosis .

  • Proteomic Profiling: MALDI-TOF MS identifies Brucella species via mscL and other surface proteins, though biovar discrimination remains challenging .

Expression and Purification

ParameterDetails
Host OrganismE. coli
Purification TagN-terminal His-tag
Storage-20°C/-80°C in Tris-based buffer with 50% glycerol

Functional Assays

  • Patch-Clamp Electrophysiology: Measures conductance changes under applied pressure .

  • Membrane Reconstitution: Lipid bilayer experiments assess channel activity post-expression .

Challenges and Future Directions

  • Structural Elucidation: Open-state structures remain unresolved, limiting drug design .

  • Resistance Mechanisms: While mscl-targeting antimicrobials show promise, Brucella’s adaptive resistance (e.g., via rpoB mutations) complicates treatment .

  • Biovar-Specific Studies: Biotype 1 vs. 2 mscL (UniProt C0RH35) differ in sequence, necessitating comparative analyses .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
mscL; BMEI1605; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-138
Protein Length
full length protein
Species
Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)
Target Names
mscL
Target Protein Sequence
MLKEFQEFALKGNMVDLAIGVIIGGAFGGLVNSIVNDIIMPIIGLITGGIDFSNMFIQLA GDPKTTLAAAREAGATIAYGNFITLLINFLIIAWVLFLVVKLMNRLKKREEAKPAPAAPS EEVLLTEIRDILAKQQKA
Uniprot No.

Target Background

Function

A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating cellular osmotic pressure changes.

Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the differences between B. melitensis biotype 1 and biotype 2 mscL proteins?

Comparative analysis of B. melitensis biotype 1 and biotype 2 mscL proteins reveals identical amino acid sequences (138 amino acids) and similar structural properties . This conservation is notable considering the differences observed in other proteins between these biotypes.

Despite their identical sequences, these proteins have different UniProt IDs:

  • Biotype 1: Q8YFB7 (BMEI1605)

  • Biotype 2: C0RH35 (BMEA_A0356)

The genomic context may differ slightly between biotypes, though the functional significance of these differences has not been extensively characterized in the literature .

What expression systems are used for recombinant B. melitensis mscL production?

The most commonly employed expression system for recombinant B. melitensis mscL is Escherichia coli, specifically strains optimized for protein expression such as BL21(DE3) . The general methodology involves:

  • Amplification of the mscL gene from B. melitensis genomic DNA

  • Cloning into expression vectors (commonly pET-based systems with His-tag for purification)

  • Transformation into E. coli expression hosts

  • Induction of protein expression (typically with IPTG)

  • Cell lysis and protein purification using affinity chromatography

While E. coli is most common, studies comparing different expression systems have found that Pichia pastoris may offer advantages for certain Brucella proteins, providing higher expression levels and potentially better immunogenicity for some recombinant antigens .

What purification strategies yield optimal results for recombinant B. melitensis mscL?

Based on the available literature, the following purification strategy has proven effective for recombinant B. melitensis mscL :

  • Expression with affinity tag: N-terminal His-tag fusion facilitates one-step purification

  • Cell lysis: Typically using sonication or commercial lysis buffers in the presence of protease inhibitors

  • Affinity purification: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Buffer formulation: Final storage in Tris/PBS-based buffer with 6% trehalose, pH 8.0

  • Storage stabilization: Addition of 50% glycerol for long-term storage at -20°C/-80°C

Researchers should pay particular attention to protein solubility, as membrane proteins like mscL may form inclusion bodies. Optimization of induction conditions (temperature, IPTG concentration, duration) is critical for maximizing soluble protein yield .

How can protein stability of recombinant mscL be maintained during storage?

Maintaining stability of recombinant mscL requires attention to several factors:

  • Buffer composition: Tris/PBS-based buffers with pH 8.0 have been reported as optimal

  • Cryoprotectants: Addition of 6% trehalose helps maintain protein structure during freeze-thaw cycles

  • Storage recommendations:

    • Lyophilized form: 12 months at -20°C/-80°C

    • Liquid form: 6 months at -20°C/-80°C

    • Working aliquots: Up to one week at 4°C

  • Aliquoting: Dividing into single-use aliquots is essential as repeated freeze-thaw cycles significantly reduce protein activity

  • Reconstitution: For lyophilized protein, reconstitution in deionized sterile water to 0.1-1.0 mg/mL is recommended

Studies have shown that adding glycerol to a final concentration of 50% significantly extends shelf life during storage at -20°C/-80°C .

How can recombinant mscL be incorporated into multi-subunit vaccine strategies against brucellosis?

Research on subunit vaccines against brucellosis suggests that combining multiple recombinant proteins often provides superior protection compared to single-antigen approaches . When considering mscL for inclusion in such vaccines:

  • Antigen combination strategy: Studies with other Brucella proteins have shown that combining outer membrane proteins (Omps) with ribosomal proteins yields enhanced immune responses. For example, a combination of Omp10, Omp28, and L7/L12 demonstrated significant protective efficacy .

  • Adjuvant selection: The addition of appropriate adjuvants significantly enhances protective efficacy. Research on Omp-based vaccines found that TPPPS (Taishan Pinus massoniana pollen polysaccharide) significantly improved protective effects of subunit vaccines against B. melitensis challenge .

  • Expression system impact: The choice of expression system affects immunogenicity. For instance, the Omp10-Omp28-L7/L12 recombinant protein expressed in Pichia pastoris exhibited slightly higher immunogenicity than the same protein expressed in E. coli .

  • Immune response profiling: Effective vaccine candidates should induce both humoral and cell-mediated immunity. In mouse models, successful subunit vaccines elicited:

    • Increased CD4+ and CD8+ T lymphocytes

    • Enhanced production of IFN-γ and IL-2 (Th1 cytokines)

    • Balanced IgG2a/IgG1 antibody responses

While mscL has not been specifically tested in multi-subunit vaccine formulations, its conservation and surface exposure make it a candidate worth investigating in combination with established immunogens such as Omp28, L7/L12, and VirB proteins.

How do experimental approaches for studying mscL function differ between biotypes of B. melitensis?

Studying mscL function across different B. melitensis biotypes requires carefully designed experimental approaches to account for biotype-specific characteristics:

  • Genomic considerations: While the mscL protein sequence is identical between biotypes 1 and 2, genomic context differences necessitate biotype-specific primer design for gene amplification. Studies have shown that biotyping through PCR-RFLP methods can distinguish biotypes reliably .

  • Strain selection: For biotype 1, strain 16M (ATCC 23456) is the reference strain, while for biotype 2, strain ATCC 23457 is commonly used . The choice of reference strain affects experimental standardization and comparative analyses.

  • Virulence correlation: Biotype distribution varies geographically, with studies showing different prevalence patterns. For example, one study in Saudi Arabia found that 41% of isolates were biovar 1, 56% biovar 2, and 2% biovar 3 . These distribution patterns may correlate with different virulence profiles that affect mscL function studies.

  • Transcriptomic analysis: Comparative transcriptome analysis between biotypes can reveal differential gene regulation patterns. Similar approaches comparing virulent and attenuated strains have identified differentially expressed genes that contribute to pathogenesis .

  • Protein-protein interaction networks: Biotype-specific protein interaction networks may affect mscL function and should be considered when designing experiments to study channel activity and regulation.

What structural and functional comparisons can be made between B. melitensis mscL and homologs in other bacterial species?

Comparative analysis of B. melitensis mscL with homologs in other bacterial species reveals important structural and functional insights:

SpeciesProtein LengthSequence Similarity to B. melitensis mscLNotable DifferencesReference
Bacillus subtilis130 aaModerateShorter C-terminal domain
Mycobacterium tuberculosis151 aaModerateExtended cytoplasmic domain
Escherichia coli~136 aaModerateDifferences in transmembrane regions
Psychrobacter sp.143 aaHighAdditional N-terminal residues

Functional differences between these homologs include:

  • Channel gating mechanisms: The hydrophobic constriction that forms the gate may have species-specific amino acid compositions

  • Pressure sensitivity thresholds: Different homologs activate at different membrane tension thresholds

  • Ion selectivity: While primarily mechanosensitive, subtle differences in pore structure may affect ion preference

  • Regulatory mechanisms: Interactions with other membrane components may differ between species

Understanding these differences is crucial for leveraging structural information from better-characterized homologs (like E. coli MscL) when studying the B. melitensis protein . Crystal structure analysis of MscL from M. tuberculosis at 3.5 Å resolution revealed a homopentameric channel that undergoes extensive rearrangement during opening, which likely applies to the B. melitensis homolog as well .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.