Recombinant Brucella melitensis biotype 1 Lectin-like protein BA14k (BMEII0552)

Shipped with Ice Packs
In Stock

Description

Introduction

Brucella melitensis is a facultative intracellular bacterium that causes brucellosis, a zoonotic disease affecting humans and livestock . The Recombinant Brucella melitensis biotype 1 Lectin-like protein BA14k (BMEII0552), also known as BA14K, is a 14-kDa protein that has been identified as an immunogenic protein in animals infected with Brucella spp . This protein exhibits lectin-like properties and is essential for the virulence of the species .

Characteristics and Properties

BA14K has immunoglobulin-binding and hemagglutination properties and can bind to mannose . The predicted amino acid sequence of BA14K shows no significant homology with previously described proteins . It is expressed as a full-length protein consisting of 27-147 amino acids .

Gene Cloning and Characterization

The gene encoding BA14K has been cloned and characterized . Southern blot analysis has identified sequences homologous to the cloned fragment encoding BA14K in genomic DNAs from representatives of all currently recognized Brucella species .

Role in Virulence

BA14K is essential for the virulence of Brucella abortus, likely due to its direct or indirect role in the synthesis of smooth lipopolysaccharide (LPS) . Disruption of the gene encoding the 14-kDa protein in virulent B. abortus strain 2308 induces a rough-like phenotype with an altered smooth LPS immunoblot profile and a significant reduction in the bacterium's ability to replicate in mouse spleens .

Immunogenicity

BA14K is a strongly immunoreactive protein that induces both humoral and cellular immune responses in hosts during infection . BA14K-specific humoral immune responses have been detected in relevant natural and experimental hosts . BA14K-reactive T lymphocytes have also been detected in experimentally infected BALB/c mice .

Potential as a Vaccine Candidate

Recombinant protein-based subunit vaccines are considered promising alternatives against brucellosis . Studies suggest that BA14K warrants further investigation regarding its biological significance in immune responses . Further research could determine if BA14K-reactive lymphocytes are present in naturally infected hosts or infected humans . Information from such studies may provide insight into the antigenic specificity of protective immunity to brucellosis .

Recombinant Production

Recombinant BA14K can be produced in E. coli as a His-tagged protein .

Biochemical Functions

BA14K has several biochemical functions. Some functions are performed with other proteins, while others are performed by BA14K alone .

Protein Interactions

BA14K has direct interactions with proteins and molecules, as detected by methods such as yeast two-hybrid, co-IP, and pull-down assays .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
BMEII0552; Lectin-like protein BA14k
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
27-147
Protein Length
Full Length of Mature Protein
Species
Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)
Target Names
BMEII0552
Target Protein Sequence
APMNMDRPAINQNVIQARAHYRPQNYNRGHRPGYWHGHRGYRHYRHGYRRHNDGWWYPLA AFGAGAIIGGAISQPRPVYRAPAGSPHVQWCYSRYKSYRASDNTFQPYNGPRKQCRSPYS R
Uniprot No.

Target Background

Function

This lectin-like protein exhibits immunoglobulin-binding and hemagglutination activities and binds to mannose. It is crucial for virulence and may be involved in lipopolysaccharide (LPS) biosynthesis or polysaccharide transport.

Database Links
Protein Families
BA14k family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the molecular structure and characterization of BA14k protein?

BA14k is a 14-kilodalton protein originally identified in Brucella abortus but present across all six recognized Brucella species. Molecular characterization reveals it consists of 133 amino acids in its native form. When expressed in E. coli as a recombinant protein, it is typically produced as a fusion protein with the N-terminal 13 amino acids of the β-subunit of β-galactosidase .

The protein exhibits lectin-like properties, specifically demonstrating affinity for mannose as evidenced by hemagglutination inhibition experiments. This lectin-like characteristic is likely fundamental to its biological function in Brucella species .

Complete gene sequencing confirms homologous sequences are present across all recognized Brucella species, suggesting evolutionary conservation of this protein and its potential importance in bacterial physiology and virulence .

How does BA14k contribute to Brucella virulence?

BA14k plays an essential role in Brucella virulence through multiple mechanisms:

  • LPS Biosynthesis Contribution: Disruption of the gene encoding BA14k in virulent B. abortus strain 2308 induces a rough-like phenotype with altered smooth lipopolysaccharide (LPS) profiles, suggesting direct or indirect involvement in LPS synthesis .

  • Host Colonization Impact: Mutant strains with disrupted BA14k genes show significant reduction in replication capacity within mouse spleens. Specifically, while wild-type strains show progressive multiplication, mutant strains maintain steady but non-expanding populations (2.0-2.6 log10 CFU/spleen) over a 6-week infection period following intraperitoneal inoculation .

  • Strain-Dependent Effects: The impact of BA14k disruption differs between smooth virulent strains (like 2308) and rough attenuated strains (like RB51). In rough strains, BA14k disruption does not affect mouse clearance patterns, suggesting its role is specifically linked to processes in smooth strains .

These findings collectively demonstrate that BA14k contributes to virulence primarily through maintaining proper cell envelope structure, which is crucial for evading host immune responses and establishing persistent infection.

What immunological responses does BA14k elicit in infected hosts?

BA14k elicits robust immunological responses across multiple host species during Brucella infection:

  • Humoral Immunity: The protein induces strong antibody responses, particularly IgG-type antibodies, which are directly correlated with active Brucella infections. These BA14k-specific antibodies have been detected in:

    • Naturally infected hosts including cattle, goats, dogs, and humans

    • Experimentally infected BALB/c mice

    • Experimentally infected goats

  • Cellular Immunity: BA14k stimulates significant T-lymphocyte responses. Lymphocyte proliferation assays using T-cell-enriched splenocytes from infected BALB/c mice demonstrate that:

    • T lymphocytes reactive with BA14k are present in mice infected with virulent strains (B. melitensis 16M, B. abortus 2308)

    • Similar responses occur in mice infected with attenuated vaccine strain 19

    • Positive proliferative responses (stimulation indices >3) are detected 28-30 weeks post-infection

This dual activation of both humoral and cellular immunity suggests BA14k could be a promising candidate for development of diagnostic tests and subunit vaccines against brucellosis.

What experimental approaches are most effective for studying BA14k protein-host interactions?

Effective experimental approaches for studying BA14k protein-host interactions include:

  • Recombinant Protein Production Systems:

    • Cloning the BA14k gene into expression vectors like pUC9

    • Expression in E. coli systems (JM109, DH5α) with IPTG induction

    • Purification of recombinant protein for subsequent assays

  • Immunological Assays:

    • Western blot analysis using sera from infected hosts to detect antibody responses

    • ELISA for quantitative measurement of antibody titers

    • T-cell proliferation assays using [³H]thymidine incorporation:

      • Culture T-cell-enriched splenocytes with purified BA14k

      • Include positive controls (ConA) and appropriate negative controls

      • Measure stimulation indices (SI >3 considered positive response)

      • Analyze at multiple time points (48, 72, 96, and 120h)

  • Functional Characterization:

    • Hemagglutination assays to assess lectin activity

    • Hemagglutination inhibition with various sugars to determine binding specificity

    • Immunoglobulin binding assays to evaluate potential immune evasion mechanisms

  • Gene Disruption and Virulence Studies:

    • Create gene knockout mutants in both smooth and rough Brucella strains

    • Assess phenotypic changes including LPS profile alterations

    • Mouse infection models with intraperitoneal inoculation

    • Sequential organ collection and CFU determination to measure bacterial replication and persistence

These methodological approaches provide complementary data on both structural/functional characteristics and host interaction dynamics of BA14k.

How does BA14k integrate with quorum sensing pathways in Brucella melitensis?

The integration of BA14k (BMEII0552) with quorum sensing (QS) pathways in Brucella melitensis reveals sophisticated regulatory networks:

  • Regulatory Context: B. melitensis possesses a QS system involving:

    • Production of N-acyl-homoserine lactones (AHLs), specifically dodecanoyl-homoserine lactone (C12-HSL)

    • Two LuxR-type transcriptional regulators: VjbR and BabR

  • VjbR-Mediated Regulation: VjbR is a critical transcriptional regulator that:

    • Controls expression of multiple virulence factors including the VirB type four secretion system

    • Regulates numerous outer membrane proteins (Omps)

    • Directly or indirectly influences expression of approximately 9% of the B. melitensis genome

  • BA14k in the QS Regulon: While specific direct regulation data is limited, chromatin immunoprecipitation (ChIP) studies have demonstrated that VjbR directly regulates several outer membrane proteins sharing similar functional characteristics with BA14k, suggesting potential inclusion of BA14k in the QS regulon .

  • Phenotypic Connection: The regulatory relationship is further supported by phenotypic observations:

    • VjbR mutant strains exhibit aggregation in liquid cultures and produce exopolysaccharides associated with biofilm formation

    • BA14k's lectin-like properties and role in cell envelope integrity align with these phenotypes

    • Both systems impact virulence and adaptation to environmental stresses encountered during infection

Understanding this relationship provides insight into how B. melitensis coordinates virulence factor expression in response to population density and environmental conditions during its intracellular lifecycle.

What are the methodological challenges in resolving the three-dimensional structure of BA14k?

Determining the three-dimensional structure of BA14k presents several methodological challenges that researchers must address:

  • Protein Expression and Purification:

    • Obtaining sufficient quantities of soluble, correctly folded protein

    • Previous studies have expressed BA14k as fusion proteins in E. coli, but this may introduce structural artifacts

    • Designing optimal constructs that maintain native conformation while facilitating purification requires iterative optimization

  • Post-Translational Modifications:

    • If BA14k undergoes post-translational modifications in Brucella, these may be absent in recombinant systems

    • Bacterial expression systems may not accurately reproduce these modifications

    • Structural studies must account for potential differences between recombinant and native proteins

  • Crystallization Barriers:

    • Lectin-like proteins often have flexible domains that complicate crystallization

    • Mannose-binding regions may require ligand co-crystallization to stabilize

    • Multiple crystallization conditions must be screened, potentially including:

      • Various buffers, precipitants, and additives

      • Co-crystallization with potential binding partners

      • Surface engineering to promote crystal contacts

  • NMR Spectroscopy Alternatives:

    • For proteins resistant to crystallization, NMR offers an alternative approach

    • Size limitations (14 kDa is within range but challenging)

    • Requires isotopic labeling (¹⁵N, ¹³C) in minimal media, which may reduce yield

    • Assignment of resonances can be complex for proteins with low sequence complexity regions

  • Functional Validation of Structures:

    • Confirming that structural data correlates with functional properties

    • Designing mutation studies to validate ligand binding sites

    • Reconciling structural data with immunological and virulence properties

Addressing these challenges requires integrated approaches combining biochemical characterization, computational predictions, and multiple structural biology techniques.

How can BA14k be leveraged for development of novel vaccines against brucellosis?

BA14k presents several promising attributes for development of novel brucellosis vaccines:

  • Immunogenicity Profile:

    • Stimulates both humoral (antibody) and cellular (T-lymphocyte) responses

    • Induces IgG-class antibodies correlated with protection

    • Generates long-lasting T-cell responses detectable 28-30 weeks post-infection

    • Cross-reactive across multiple Brucella species

  • Subunit Vaccine Development Strategy:

    • Recombinant BA14k can be produced in high quantities using optimized expression systems

    • Potential administration platforms include:

      • Protein-adjuvant formulations

      • DNA vaccines encoding BA14k

      • Viral vector delivery systems

      • Nanoparticle-based delivery

  • Rational Modifications for Enhanced Efficacy:

    Modification ApproachRationaleExperimental Validation Method
    Epitope optimizationEnhance presentation of protective epitopesT-cell epitope mapping and immunization studies
    Adjuvant selectionPromote appropriate Th1/Th17 biasCytokine profiling and challenge studies
    Carrier protein fusionImprove uptake by APCsDendritic cell activation assays
    Multi-antigen combinationsBroaden protective coverageSynergy assessment in animal models
  • Validation Protocols:

    • Mouse model immunization followed by challenge with virulent strains

    • Assessment of bacterial burden in spleen and liver

    • Cytokine profiling to confirm appropriate Th1/Th17 responses

    • Antibody subclass determination and correlation with protection

  • Potential Limitations to Address:

    • Strain specificity considerations (B. melitensis vs. B. abortus)

    • Adjuvant selection to avoid Th2-biased responses

    • Verification that anti-BA14k responses don't interfere with diagnostic tests

This methodological framework provides a comprehensive approach to exploiting BA14k's immunological properties for vaccine development while addressing potential challenges.

How can researchers resolve inconsistent results in BA14k expression systems?

Inconsistent results in BA14k expression systems can be systematically resolved through the following approaches:

  • Optimizing Expression Constructs:

    • Review cloning junctions to ensure in-frame fusion

    • Compare expression with and without fusion tags

    • Consider codon optimization for the expression host

    • Evaluate native vs. synthetic signal sequences

  • Expression Conditions Optimization:

    • Test multiple induction parameters:

      • IPTG concentration gradients (0.1-1.0 mM)

      • Induction temperature variation (16°C, 25°C, 37°C)

      • Induction timing (early vs. mid-log phase)

    • Evaluate different E. coli strains (BL21, JM109, DH5α)

    • Implement auto-induction media formulations

  • Addressing Solubility Issues:

    • Include solubility-enhancing fusion partners (MBP, SUMO, thioredoxin)

    • Test extraction buffers with various detergents

    • Implement refolding protocols from inclusion bodies if necessary

  • Purification Troubleshooting:

    • Compare multiple purification approaches:

      • Affinity chromatography (His-tag, GST)

      • Ion exchange chromatography

      • Size exclusion chromatography

    • Optimize buffer conditions to maintain protein stability

    • Include lectin-affinity chromatography leveraging mannose-binding properties

  • Quality Control Measures:

    • Implement thorough validation of recombinant protein:

      • Mass spectrometry confirmation

      • N-terminal sequencing

      • Functional assays (lectin activity, antibody reactivity)

      • Thermostability assessment

By systematically addressing these variables, researchers can establish reproducible protocols for BA14k expression and purification, ensuring consistent quality for downstream applications.

What strategies can resolve contradictory immunological responses in different host species?

When confronted with contradictory immunological responses to BA14k across different host species, researchers should implement the following methodological strategies:

  • Standardized Antigen Preparation:

    • Ensure consistent recombinant protein quality across experiments

    • Validate protein folding and activity before immunological testing

    • Quantify endotoxin levels that might confound immune responses

  • Comprehensive Host Response Assessment:

    • Implement parallel testing across multiple species (mice, goats, cattle, humans)

    • Standardize sampling timepoints relative to infection/immunization stage

    • Measure multiple immune parameters:

      • Antibody isotypes (IgG1, IgG2a, IgG2b, IgA)

      • Cytokine profiles (IFN-γ, IL-4, IL-17, TNF-α)

      • T-cell response characterization (CD4+ vs. CD8+)

  • Experimental Design Refinements:

    • Implement factorial designs to identify species-specific variables

    • Include age-matched controls across species

    • Account for pre-existing immunity to Brucella

    • Control for genetic heterogeneity within species

  • Advanced Analytical Approaches:

    Analytical MethodApplicationOutcome Measure
    Flow cytometryCellular immune profilingQuantification of specific immune cell populations
    ELISpotT-cell response assessmentEnumeration of cytokine-producing cells
    Systems serologyAntibody functionalityBeyond titer: Fc-mediated functions
    TranscriptomicsHost response patternsIdentification of differentially regulated pathways
  • Reconciliation Strategies:

    • Identify species-specific epitopes through epitope mapping

    • Determine if proteolytic processing differs between species

    • Evaluate MHC presentation differences across species

    • Consider pathogen burden and exposure variables

By implementing these methodological refinements, researchers can identify whether contradictory results stem from technical variables or represent true biological differences in host responses to BA14k, advancing our understanding of species-specific immunity to Brucella.

What emerging technologies could enhance structural and functional characterization of BA14k?

Several cutting-edge technologies offer promising approaches for deeper characterization of BA14k:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Single-particle analysis for high-resolution structural determination without crystallization

    • Visualization of BA14k in complex with interaction partners

    • Potential for observing conformational changes upon ligand binding

  • AlphaFold2 and Structure Prediction:

    • Implementation of AI-based structural prediction

    • Integration with limited experimental data for refinement

    • Prediction of protein-protein interaction interfaces

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Mapping of ligand binding sites through differential solvent accessibility

    • Characterization of conformational dynamics upon mannose binding

    • Identification of regions involved in protein-protein interactions

  • Advanced Glycan Arrays:

    • High-throughput screening of glycan binding preferences

    • Quantitative assessment of binding affinities

    • Identification of host-relevant glycan targets

  • CRISPR-Based Approaches:

    • CRISPRi for conditional depletion studies in Brucella

    • CRISPR-Cas9 base editing for targeted mutagenesis

    • CRISPRa for overexpression studies in relevant models

  • Single-Cell Technologies:

    • Single-cell RNA-seq to characterize host cell responses to BA14k

    • Mass cytometry to profile immune cell activation patterns

    • Spatial transcriptomics to map infection microenvironments

  • Microfluidic Systems:

    • Real-time measurement of BA14k-glycan interactions

    • Host-pathogen interaction studies in controlled microenvironments

    • High-throughput screening of inhibitory compounds

Integration of these emerging technologies can overcome current limitations in BA14k characterization and provide unprecedented insights into its structure-function relationships and role in Brucella virulence.

How can systems biology approaches enhance understanding of BA14k's role in Brucella pathogenesis?

Systems biology offers integrative frameworks to comprehensively understand BA14k's role in Brucella pathogenesis:

  • Multi-Omics Integration:

    • Combine transcriptomics, proteomics, and metabolomics data from:

      • Wild-type Brucella vs. BA14k mutants

      • Infected vs. uninfected host cells

      • Different stages of infection

    • Identify regulatory networks and metabolic pathways influenced by BA14k

    • Map temporal dynamics of BA14k-dependent processes

  • Network Analysis Approaches:

    • Construct protein-protein interaction networks centered on BA14k

    • Identify hub proteins and signaling cascades connected to BA14k

    • Model the impact of BA14k disruption on cellular network topology

  • Computational Modeling:

    • Develop mechanistic models of BA14k's role in LPS biosynthesis

    • Simulate the impact of BA14k on bacterial surface properties

    • Model host-pathogen interaction dynamics dependent on BA14k

  • Integration with Host Response Data:

    • Correlate BA14k expression with host transcriptional responses

    • Map immune evasion mechanisms potentially linked to BA14k

    • Identify host targets of BA14k's lectin activity

  • Comparative Systems Analysis:

    System ComponentWild-type BrucellaBA14k MutantAnalytical Method
    Membrane integritySmooth phenotypeRough-like phenotypeLipidomics, electron microscopy
    Stress responseNormal adaptationAltered response patternsTranscriptomics under stress conditions
    Host cell interactionsEffective invasion and replicationImpaired intracellular lifecycleSingle-cell RNA-seq of infected cells
    Metabolic adaptationEfficient utilization of host resourcesPotential metabolic bottlenecksMetabolic flux analysis
  • In Silico Drug Target Identification:

    • Virtual screening against BA14k structure

    • Network-based identification of synthetic lethal interactions

    • Prediction of resistance mechanisms

These systems approaches shift from reductionist to holistic understanding of BA14k's functions, contextualizing its role within the broader pathogenesis mechanisms of Brucella species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.