Recombinant Brucella melitensis biotype 1 Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Relevance

Recombinant Brucella melitensis biotype 1 YidC is a synthetic version of the native membrane protein insertase YidC, engineered for research purposes. Native YidC belongs to the Oxa1 superfamily and facilitates the co-translational integration of membrane proteins into bacterial membranes, either independently or in collaboration with the Sec translocon . The recombinant form retains this functionality while enabling controlled studies of membrane biogenesis, lipid organization, and protein-lipid interactions .

Functional Roles

RoleMechanismKey Substrates
Membrane InsertaseBinds hydrophobic segments of nascent proteins; induces lipid bilayer thinning .M13 procoat, Pf3 coat proteins, SecG .
Lipid ScramblaseDisrupts membrane asymmetry, aiding lipid organization .N/A
ChaperoneStabilizes multi-pass proteins during folding .ATP synthase subunit F0c .

Functional Interactions

  • YibN Interaction:

    • YibN (a novel interactor) enhances YidC-mediated insertion of substrates (e.g., M13 procoat, ATP synthase F0c) by 2–3 fold .

    • Mechanism: YibN stabilizes YidC-substrate complexes via hydrophobic interactions in the membrane core .

  • Sec Translocon Collaboration:

    • YidC’s cytoplasmic hairpin binds ribosomal RNA helix 59, guiding nascent chains into the membrane .

    • Cryo-EM Data: Single YidC molecules interact with ribosomes at the tunnel exit, directing substrates to lipid-facing grooves .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your preference.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference for your reconstitution.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles to maintain protein integrity.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
yidC; BMEII0275; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-610
Protein Length
full length protein
Species
Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)
Target Names
yidC
Target Protein Sequence
MENKRNFFITIALSILILALWQVFYLGPKTEAQREQARIEEQQRQAQQAAQNRQASSSTG DTPQMPANPDSIPGQGDTKAAGAPLTRDAAIAQSPRIEIDTPSLRGSINLTGARLDDLYL KKYHETVSDKSPEIELLAPSSLKQGYFVELGFTGNDATGAVPGPNTVWVVEGNNKLTPST PVTLTYTNDKNLTFKRVISVDDAYMFTVDDTIINNGGSTVSLASYGRVTRFNQPEHASAT YVLHEGLIGVMGQDGLQEIKYAKIEDNKDISFKDVIGGWVGITDKYWAATLIPPQDEKFT GRFSHFTNDRPRYQSDLLSAPLTVAPGQSQKIQNRVFAGAKVVNTIQNYETKYHIKQFDL LIDWGWFYFITKPMFYLIDWIYKFTGNFGVAILVVTVLLKALFFPLANKSYKSMARMKLM QPKMTEIREKYADDKMKQQQAMMELYKREKINPLAGCWPVLVQIPVFFALYKVLYVTIEM RHAPFFGWIQDLAAPDPTSIFNLFGLLPYTVPHFLMIGVWPIIMGIIMFLQMRMNPTPPD PTQAAIFTWMPIIFTFMLASFPAGLVIYWAWNNTLSIIQQSVIMKRQGVKIELFDNLKGL FRRKPKEANK
Uniprot No.

Target Background

Function
Essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. Facilitates the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YidC in Brucella melitensis and what is its primary function?

YidC in Brucella melitensis (designated as BMEII0275) is a membrane protein insertase that belongs to the YidC/Oxa1/Alb3 protein family. The primary function of YidC is to facilitate the insertion, folding, and assembly of membrane proteins into the bacterial cytoplasmic membrane .

The complete amino acid sequence of Brucella melitensis biotype 1 YidC consists of 610 amino acids, with multiple transmembrane domains that are critical for its function in membrane protein integration. The protein is also referred to as "Foldase YidC" or "Membrane integrase YidC" in scientific literature, reflecting its role in protein folding and membrane integration processes .

YidC functions both independently and in cooperation with the Sec translocon to mediate the insertion of various substrate proteins. It plays a crucial role in maintaining membrane protein homeostasis, which is essential for bacterial viability and pathogenicity .

How does the structure of Brucella melitensis YidC compare to YidC proteins in other bacterial species?

Brucella melitensis YidC shares structural similarities with other bacterial YidC proteins, particularly in the transmembrane domains and functional regions involved in substrate binding and membrane insertion. The protein contains conserved domains characteristic of the YidC/Oxa1/Alb3 family, which are present across diverse bacterial species .

Key structural features include:

  • Multiple transmembrane segments that form a hydrophilic groove within the membrane

  • A cytoplasmic domain that may interact with ribosomes during co-translational insertion

  • A periplasmic domain that may be involved in protein folding or quality control

Despite these conserved features, Brucella melitensis YidC may possess unique structural adaptations that could relate to the specific membrane composition of this pathogen and its intracellular lifestyle within host cells. These adaptations may contribute to Brucella's virulence and survival mechanisms .

What is the genomic context of the yidC gene in Brucella melitensis biotype 1?

The yidC gene in Brucella melitensis biotype 1 is designated as BMEII0275, indicating its location on chromosome II of the Brucella melitensis genome. This genomic location suggests potential co-regulation with other genes involved in membrane protein biogenesis or cell envelope maintenance .

The genomic context of yidC may include genes involved in related cellular processes such as protein secretion, membrane biogenesis, or stress response pathways. Understanding this context can provide insights into the regulatory networks controlling YidC expression and function in Brucella melitensis, which may differ from other bacterial species due to the unique pathogenic lifestyle of Brucella .

What purification strategies are most effective for obtaining high-quality recombinant YidC protein?

Purifying membrane proteins like YidC presents significant challenges due to their hydrophobic nature. Based on successful approaches with similar proteins, the following purification strategy is recommended:

  • Membrane fraction isolation: After cell lysis (preferably by sonication), the membrane fraction should be isolated by ultracentrifugation .

  • Solubilization: Mild detergents such as n-dodecyl-β-D-maltoside (DDM) or CHAPS at 1-2% concentration are effective for solubilizing membrane proteins without causing denaturation .

  • Affinity chromatography: If expressed with a His-tag, nickel affinity chromatography using His-Grab plates or Ni-NTA resin is effective. The protocol can include:

    • Equilibration with buffer containing 0.1% detergent

    • Sample loading at slow flow rate (0.5 ml/min)

    • Washing with buffer containing 20-40 mM imidazole

    • Elution with buffer containing 250-500 mM imidazole

  • Secondary purification: Size exclusion chromatography can be used to achieve higher purity and remove aggregates.

  • Quality assessment: SDS-PAGE, Western blotting (using anti-His or anti-V5 antibodies), and mass spectrometry should be used to confirm protein identity and purity .

The purification buffer composition is critical and should typically include:

  • 50 mM Tris-HCl or phosphate buffer (pH 7.5-8.0)

  • 150-300 mM NaCl

  • 0.1% appropriate detergent

  • 10% glycerol as stabilizer

  • Protease inhibitors

How can researchers effectively analyze the membrane insertion activity of YidC in vitro?

Analyzing YidC's membrane insertion activity requires specialized assays that monitor its ability to facilitate membrane protein integration. Based on studies of YidC proteins, the following methodological approaches are recommended:

  • Proteoliposome reconstitution assay:

    • Purified YidC should be reconstituted into liposomes composed of E. coli phospholipids or synthetic lipid mixtures mimicking Brucella membrane composition

    • Substrate proteins (such as Pf3 coat protein or Foc) labeled with fluorescent tags or radioactive isotopes can be used to monitor insertion

    • Successful insertion can be detected by protease protection assays, where properly inserted domains are protected from external protease digestion

  • Site-directed crosslinking:

    • Introducing crosslinkable amino acids at specific positions in YidC and substrate proteins

    • Analyzing crosslinked products by SDS-PAGE and immunoblotting to map interaction sites

    • This approach reveals specific contacts between YidC and substrates during the insertion process

  • Fluorescence resonance energy transfer (FRET):

    • Labeling YidC and substrate proteins with FRET pairs

    • Measuring energy transfer as an indication of proximity during insertion

    • This technique allows real-time monitoring of the insertion process

  • Single-molecule techniques:

    • Atomic force microscopy or single-molecule FRET to observe conformational changes during insertion

    • These advanced approaches can provide insights into the dynamics of the insertion process

For data analysis and interpretation, controls should include:

  • YidC variants with mutations in key functional residues

  • Other membrane insertases for comparison

  • Liposomes without YidC to establish baseline insertion levels

Can YidC serve as a target for vaccine development against Brucella melitensis?

YidC has several characteristics that make it a potential candidate for vaccine development against Brucella melitensis:

  • Surface exposure: Portions of YidC likely have domains exposed on the bacterial surface, making them accessible to the host immune system .

  • Conservation: YidC is highly conserved among Brucella species and strains, suggesting that immunity against YidC could provide broad protection against different Brucella isolates .

  • Essential function: As a protein essential for bacterial viability, YidC represents a target that the pathogen cannot easily modify or eliminate to evade immunity .

Research on other Brucella membrane proteins supports this potential:

  • The recombinant outer membrane protein Omp31 from B. melitensis has shown promising results in vaccine studies, providing protection against both B. melitensis and B. ovis infection. Similar approaches could be applied to YidC or its immunogenic epitopes .

  • Peptide vaccines based on identified T-cell epitopes from Brucella proteins have shown protective efficacy. Mapping of immunogenic epitopes in YidC could lead to peptide-based vaccine candidates .

For vaccine development, researchers should consider:

  • Identifying immunogenic regions of YidC through epitope mapping

  • Evaluating both humoral and cell-mediated immune responses to recombinant YidC

  • Testing protection in appropriate animal models

  • Comparing YidC-based vaccines with existing vaccine approaches

What immune responses are induced by Brucella melitensis membrane proteins like YidC?

Studies on immune responses to Brucella membrane proteins provide insights into potential responses to YidC:

  • Humoral immunity:

    • Recombinant Brucella membrane proteins like Omp31 induce strong IgG responses

    • In Omp31 studies, higher IgG1 than IgG2 titers were observed, though the ideal protective response may involve balanced isotype production

    • Antibodies develop early in infection (within 3 days) and persist throughout infection

  • Cell-mediated immunity:

    • CD4+ T cells: Brucella membrane proteins elicit strong CD4+ T cell responses that produce IFN-γ and IL-2, consistent with a Th1-type response critical for protection against intracellular pathogens

    • CD8+ T cells: Cytotoxic T lymphocyte activity against Brucella-infected macrophages is observed, though CD8+ T cells may have a more limited role in protection compared to CD4+ T cells

    • Specific T cell epitopes from Brucella proteins have been identified in human patients, indicating recognition by the adaptive immune system

  • Cytokine profile:

    • Protective responses are characterized by Th1 cytokines (IFN-γ, IL-2)

    • Experimental infection models show elevated levels of pro-inflammatory cytokines (IL-1β, IL-6)

    • The balance between pro-inflammatory and regulatory cytokines appears critical for controlling infection while limiting tissue damage

While these patterns are based on studies of other Brucella membrane proteins, they provide a framework for understanding potential immune responses to YidC and designing immunological assays to characterize these responses specifically .

How can conformational dynamics of YidC be studied during membrane protein insertion?

Understanding the conformational changes that YidC undergoes during membrane protein insertion requires sophisticated biophysical and structural biology approaches:

  • Molecular dynamics simulations:

    • Computational modeling of YidC structure and its interactions with substrate proteins

    • Simulation of conformational changes during the insertion process

    • Prediction of key residues involved in substrate recognition and membrane insertion

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Monitoring solvent accessibility changes in different regions of YidC in the presence and absence of substrate proteins

    • Identifying regions that undergo conformational rearrangements during the insertion process

    • This method provides information about protein dynamics in a near-native environment

  • Site-directed spin labeling coupled with electron paramagnetic resonance (EPR):

    • Introduction of spin labels at specific positions in YidC

    • Measurement of distances between labeled sites during the insertion process

    • This approach provides detailed information about conformational changes with minimal perturbation to protein function

  • Cryo-electron microscopy (cryo-EM):

    • Structural determination of YidC in different functional states

    • Visualization of YidC-substrate complexes

    • This method can capture different conformational states during the insertion process

Data from these complementary approaches should be integrated to develop a comprehensive model of YidC's conformational dynamics during membrane protein insertion, which may reveal unique aspects of Brucella YidC function compared to homologs in other bacteria .

What are the differences in substrate specificity between Brucella YidC and homologs in other bacterial species?

Understanding the substrate specificity of Brucella YidC compared to homologs in other bacteria is crucial for elucidating its unique functions in this pathogen:

Differences in substrate specificity may arise from:

  • Unique membrane composition of Brucella affecting YidC-membrane interactions

  • Co-evolution with Brucella-specific membrane proteins

  • Adaptations related to the intracellular lifestyle of this pathogen

Understanding these differences could reveal novel aspects of Brucella membrane biology and potentially identify unique vulnerabilities for therapeutic targeting .

How do post-translational modifications affect YidC function in Brucella melitensis?

Post-translational modifications (PTMs) of membrane proteins can significantly impact their function, stability, and interactions. Although specific information on PTMs of Brucella YidC is limited in the provided literature, we can outline methodological approaches to investigate this important aspect:

  • Identification of potential PTMs:

    • Mass spectrometry-based proteomics to identify phosphorylation, glycosylation, lipidation, or other modifications

    • Comparison of PTM patterns under different growth conditions or during infection

    • Bioinformatic prediction of potential modification sites based on conserved motifs

  • Functional impact assessment:

    • Site-directed mutagenesis of identified or predicted PTM sites

    • Evaluation of mutant YidC proteins for altered:

      • Membrane insertion activity

      • Substrate specificity

      • Protein stability and turnover

      • Interaction with partner proteins

  • Regulation of PTMs:

    • Identification of enzymes responsible for YidC modifications

    • Investigation of environmental signals that trigger PTM changes

    • Analysis of PTM dynamics during different stages of infection

  • Comparative analysis:

    • Assessment of whether PTMs are conserved in YidC homologs from other bacteria

    • Evaluation of whether Brucella-specific PTMs correlate with unique functional aspects

PTMs could potentially regulate YidC function in response to stress conditions encountered during infection, such as oxidative stress, nutrient limitation, or pH changes. Understanding this regulation could provide insights into Brucella adaptation mechanisms and potentially reveal new targets for therapeutic intervention .

Comparing YidC with Other Brucella Membrane Proteins

The assembly of membrane protein complexes is crucial for Brucella virulence, and YidC likely plays a significant role in this process:

  • Type IV secretion system (T4SS) assembly:

    • The T4SS, encoded by the virB operon, is essential for Brucella intracellular survival and virulence

    • Several T4SS components are membrane proteins that may require YidC for proper insertion

    • VirB5 (BMEII 0029), a T4SS component, has been identified as immunologically significant in human brucellosis patients

    • YidC could potentially facilitate the assembly of the T4SS complex, making it indirectly essential for virulence

  • Outer membrane protein biogenesis:

    • Outer membrane proteins like Omp31 are important virulence factors and immunogens

    • While the Sec translocon is the primary pathway for OMP biogenesis, YidC may assist in certain aspects of this process

    • YidC could be involved in the assembly of OMP complexes that function in adhesion, invasion, or resistance to host defenses

  • Metabolic and transport systems:

    • Brucella requires various membrane transporters to acquire nutrients within the host cell

    • YidC likely facilitates the insertion of components of these transport systems

    • Periplasmic binding proteins (such as BMEII 0691) may function in conjunction with transporters assembled by YidC

  • Stress response systems:

    • Membrane-associated stress response systems help Brucella survive hostile host environments

    • YidC may be involved in assembling these systems, contributing to Brucella's remarkable stress resistance

Research methodologies to investigate these roles could include:

  • YidC depletion studies to identify affected membrane protein complexes

  • Co-immunoprecipitation to identify YidC interaction partners

  • Bacterial two-hybrid assays to map protein-protein interactions

  • Conditional YidC mutants to assess virulence in cellular and animal infection models

What are the most pressing unanswered questions about Brucella melitensis YidC?

Despite the importance of YidC in bacterial membrane protein biogenesis, several critical questions remain unanswered specifically for Brucella melitensis YidC:

  • Structural uniqueness:

    • How does the structure of Brucella YidC differ from well-characterized homologs?

    • Are there structural adaptations specific to Brucella's intracellular lifestyle?

    • Can these structural features be exploited for targeted interventions?

  • Substrate repertoire:

    • What is the complete set of membrane proteins that depend on YidC for insertion in Brucella?

    • Are there Brucella-specific substrates not found in other bacteria?

    • How does YidC substrate specificity contribute to Brucella's unique biology?

  • Role in pathogenesis:

    • Is YidC essential for Brucella virulence in relevant infection models?

    • Does YidC function change during different stages of infection?

    • How does YidC contribute to Brucella's adaptation to the intracellular environment?

  • Immunological significance:

    • Does YidC contain epitopes recognized by the human immune system during infection?

    • Can YidC or its fragments induce protective immunity against Brucella infection?

    • How does YidC compare to other Brucella immunogens in terms of protective efficacy?

  • Regulatory mechanisms:

    • How is YidC expression regulated in Brucella under different conditions?

    • Are there post-translational modifications that regulate YidC activity?

    • Does YidC function change in response to stresses encountered during infection?

Addressing these questions would significantly advance our understanding of Brucella membrane biology and potentially reveal new approaches for intervention against this important zoonotic pathogen .

What novel methodological approaches could advance the study of Brucella YidC?

Advancing our understanding of Brucella YidC will require innovative methodological approaches that address the challenges of studying membrane proteins in this intracellular pathogen:

  • CRISPR interference (CRISPRi) for conditional knockdown:

    • Given YidC's likely essential nature, traditional knockout approaches may not be viable

    • CRISPRi systems allow titratable repression of gene expression

    • This approach can reveal phenotypes associated with reduced YidC levels without complete lethality

  • Super-resolution microscopy:

    • Techniques such as PALM, STORM, or STED microscopy

    • Visualization of YidC localization within the bacterial cell at nanometer resolution

    • Monitoring YidC dynamics during infection using fluorescent protein fusions

  • In situ structural analysis:

    • Cryo-electron tomography of Brucella cells to visualize YidC in its native membrane environment

    • Correlative light and electron microscopy to connect function with structure

    • These approaches can reveal YidC organization in the context of the bacterial cell

  • Synthetic biology approaches:

    • Creation of minimal YidC variants to identify essential functional domains

    • Engineering YidC with non-canonical amino acids for site-specific crosslinking

    • Development of activity-based probes to monitor YidC function in living cells

  • Single-cell techniques:

    • Single-cell RNA-seq to assess YidC expression heterogeneity during infection

    • Microfluidics-based approaches to monitor YidC-dependent processes in individual bacteria

    • These methods can reveal population heterogeneity that may be relevant to pathogenesis

  • Computational approaches:

    • Machine learning to predict YidC-substrate interactions

    • Molecular dynamics simulations of YidC function in the Brucella-specific membrane environment

    • These in silico methods can guide experimental design and interpretation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.