Recombinant Brucella melitensis biotype 1 Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Shipped with Ice Packs
In Stock

Description

General Information

MtgA is a monofunctional peptidoglycan transglycosylase enzyme with the EC number 2.4.2.- . It participates in the synthesis of peptidoglycan, an essential component of the bacterial cell wall . The mtgA gene, also referred to as BMEI0271, encodes this protein .

Function and Role in Peptidoglycan Synthesis

MtgA functions as a monofunctional peptidoglycan transglycosylase . Peptidoglycan transglycosylases catalyze the formation of glycan strands in peptidoglycan by linking N-acetylmuramic acid (MurNAc) and N-acetylglucosamine (GlcNAc) molecules . Peptidoglycan is crucial for maintaining cell shape and withstanding internal turgor pressure .

Role in Bacterial Interactions and Pathogenesis

Peptidoglycan fragments released during bacterial growth control many types of bacterial interactions, including symbioses and interactions between microorganisms . Brucella melitensis is an intracellular pathogen that establishes a replicative niche within macrophages .

Brucella melitensis and its Cell Envelope

Brucella species, including B. melitensis, have unique cell envelope characteristics. Multiple outer membrane proteins (OMPs) in B. abortus and Agrobacterium tumefaciens are covalently linked to the peptidoglycan via an alanyl-aspartyl motif at the protein N terminus, which is catalyzed by l,d-transpeptidases .

Synthesis and Metabolism

B. melitensis can synthesize and metabolize saturated and unsaturated fatty acids, as well as other major lipid classes such as lipid A, phospholipids, and isoprenoids . B. melitensis seems to be capable of synthesizing phosphatidylcholine, a phospholipid common in eukaryotes but rare in bacteria .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
mtgA; BMEI0271; Biosynthetic peptidoglycan transglycosylase; Glycan polymerase; Peptidoglycan glycosyltransferase MtgA; PGT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-224
Protein Length
full length protein
Species
Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)
Target Names
mtgA
Target Protein Sequence
MWGSRIAVALRILVVLAILPVFLLLVYSLPFVRPVSTLMVKDYALLQGVNRQWVDIENIA PVLVNSVMMAEDGQFCSHGGVDWHQLGLVLDDAGDGGPSRGASTITMQMVKNLFLWNGRS YLRKGLEFPLALIADAVLSRKRIMEIYLNIAEWGPGIYGIEAAARHYFKRSAAKLTARQA ALLAVTLPNPALRNPAKPTRNMQRIARIVAGRAMRSGPYVTCVK
Uniprot No.

Target Background

Function
A peptidoglycan polymerase that catalyzes glycan chain elongation from lipid-linked precursors.
Database Links
Protein Families
Glycosyltransferase 51 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is mtgA and what is its fundamental role in Brucella melitensis?

Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) is an enzyme that catalyzes glycan chain elongation during bacterial cell wall peptidoglycan synthesis. In Brucella melitensis, mtgA functions as a specialized glycosyltransferase that participates in peptidoglycan assembly. Unlike bifunctional penicillin-binding proteins (PBPs) that possess both transglycosylase and transpeptidase domains, mtgA is monofunctional, containing only the glycosyltransferase domain that transfers N-acetylglucosamine (GlcNAc) moieties during peptidoglycan polymerization.

Research demonstrates that mtgA exhibits significant glycosyltransferase activity in vitro. In experimental settings, GFP-mtgA fusion proteins have shown a 2.4-fold increase in peptidoglycan polymerization compared to control samples (26% versus 11% of lipid II substrate utilization). This activity is confirmed by the complete digestion of the polymerized material upon addition of lysozyme to the reaction products .

How does mtgA contribute to cell division in Brucella melitensis?

MtgA localizes at the division site in bacterial cells during septation, particularly under conditions where competition with Class A PBPs is reduced. This localization pattern suggests mtgA's involvement in peptidoglycan synthesis during cell division.

Studies in related bacterial systems have shown that mtgA can interact with multiple components of the divisome complex. Specifically, bacterial two-hybrid assays have demonstrated that mtgA interacts with:

  • PBP3 (a key division-specific transpeptidase)

  • FtsW (essential division protein involved in peptidoglycan precursor translocation)

  • FtsN (late cell division protein)

The β-galactosidase activity resulting from these interactions was at least 10-fold (mtgA-PBP3), 20-fold (mtgA-FtsN), and 37-fold (mtgA-FtsW) higher than control levels (~100 U/mg) . Additionally, mtgA has been shown to interact with itself, suggesting potential homodimerization during its function. These findings collectively indicate that mtgA collaborates with other division proteins to synthesize peptidoglycan at the new cell poles during bacterial division .

What expression patterns does mtgA show during Brucella infection?

The expression profile of mtgA in B. melitensis changes significantly during infection compared to broth-grown conditions. During macrophage infection, B. melitensis undergoes substantial transcriptional reprogramming, including changes in cell wall synthesis genes.

In experimental infection models using RAW 264.7 macrophages, researchers have tracked bacterial gene expression at multiple timepoints (4, 8, 24, and 48 hours post-infection). These studies reveal that genes involved in cell envelope biogenesis, including peptidoglycan synthesis enzymes, show altered expression patterns during intracellular adaptation phases .

The differential expression of cell wall synthesis genes, including mtgA, likely reflects the bacterium's adaptation to the intracellular environment and its strategy to modify peptidoglycan structure to evade host immune responses during infection progression.

How does the structure of mtgA relate to its enzymatic function?

The structure-function relationship of mtgA centers on its glycosyltransferase (GT) domain, which contains conserved motifs essential for catalytic activity. While the specific crystal structure of B. melitensis mtgA has not been fully resolved, comparative analyses with related bacterial glycosyltransferases reveal several key structural features:

  • An N-terminal transmembrane anchor domain that facilitates membrane localization

  • A catalytic domain containing essential glutamate residues that coordinate metal ions for catalysis

  • A hydrophobic region that accommodates lipid II substrate binding

  • Specific motifs that determine substrate specificity for Brucella peptidoglycan synthesis

The enzymatic mechanism involves the transfer of GlcNAc-MurNAc units from lipid II precursors to the growing glycan chain. In vitro assays using purified mtgA have demonstrated this activity through the polymerization of fluorescently labeled lipid II substrates .

Table 1: Key Functional Domains of B. melitensis mtgA

DomainApproximate PositionFunction
TransmembraneN-terminalMembrane anchoring
JuxtamembraneFollowing TM domainProtein-protein interactions
Catalytic CoreCentral portionGlycosyltransferase activity
Substrate-binding pocketWithin catalytic domainLipid II recognition
C-terminal regionC-terminusRegulatory function

What experimental approaches are most effective for studying mtgA function?

Multiple complementary approaches have proven effective for investigating mtgA function:

  • Gene expression analysis: RT-PCR and RNA-seq to quantify mtgA transcriptional changes during infection or under different growth conditions .

  • Protein localization studies: Fluorescent protein fusions (e.g., GFP-mtgA) to track subcellular localization during bacterial growth and division .

  • Protein-protein interaction assays: Bacterial two-hybrid systems have successfully identified mtgA's interactions with divisome components. The adenylate cyclase-based two-hybrid system using T18 and T25 fragment fusions has shown that mtgA interacts with PBP3, FtsW, and FtsN .

  • In vitro enzymatic assays: Purified mtgA activity can be measured using radioactively labeled lipid II substrates (e.g., 14C-GlcNAc-labeled lipid II). Reaction conditions typically include:

    • 4 nmol of labeled lipid II (~9,180 dpm/nmol)

    • 15% dimethyl sulfoxide

    • 10% octanol

    • 50 mM HEPES (pH 7.0)

    • 0.5% decyl-polyethylene glycol

    • 10 mM CaCl₂

  • Genetic manipulation approaches: Creating deletion mutants or conditional expression strains to assess the phenotypic consequences of mtgA absence or overexpression.

How does mtgA function differ between Brucella species and other bacteria?

While mtgA serves a conserved function in peptidoglycan synthesis across bacterial species, important differences exist in its regulation, essentiality, and specific interactions within different bacterial backgrounds.

In B. melitensis, mtgA appears to function alongside class A PBPs, potentially compensating for their absence under certain conditions. Research has shown that mtgA localization at the division site is more pronounced in strains deficient in PBP1b and expressing a thermosensitive PBP1a, suggesting a compensatory role .

Comparative genomic analyses across Brucella species (including B. melitensis, B. abortus, and B. canis) reveal species-specific variations in cell wall synthesis genes that may influence pathogenesis and host specificity. In experimental infections comparing B. canis and B. melitensis in macrophage models, differential expression patterns of cell envelope genes have been observed, reflecting species-specific adaptation strategies .

How do mutations in mtgA contribute to antimicrobial resistance in B. melitensis?

Antimicrobial resistance (AMR) in B. melitensis involves complex genetic mechanisms, and the potential role of mtgA mutations must be considered within this broader context. Research has revealed several important insights:

B. melitensis contains a complex network of antimicrobial resistance genes, including multiple peptide resistance factors and RND-family efflux genes (bepC, bepD, bepE, bepF, and bepG) that have been consistently identified across isolates .

Studies analyzing genetic determinants of AMR in B. melitensis have found mutations in several genes associated with antimicrobial targets, including:

  • rpoB (rifampicin resistance)

  • gyrA and parC (fluoroquinolone resistance)

  • folP (cotrimoxazole resistance)

Table 2: Selected Mutations Associated with AMR in B. melitensis

GeneMutationAssociated ResistanceConsistency with Phenotype
rpoB629-Ala(GCG)→Val(GTG)RifampicinInconsistent correlation
rpoB985-Ala(GCC)→Val(GTC)RifampicinInconsistent correlation
gyrAMultiple SNPsFluoroquinolonesNot limited to resistant isolates
folPMultiple SNPsCotrimoxazolePresent in all resistant isolates but not exclusive
Efflux genesVarious SNPsMultiple antibioticsComplex correlation patterns

Research indicates that AMR in B. melitensis likely depends on multiple genetic factors rather than single gene mutations, making the contribution of individual genes like mtgA difficult to isolate .

What is the role of mtgA in B. melitensis pathogenesis during host infection?

Understanding mtgA's role in pathogenesis requires examining its expression and function during the infection process. Several key aspects have emerged from research:

  • Differential gene expression during infection: Transcriptional profiling studies have shown that B. melitensis undergoes significant gene expression changes during macrophage infection, including alterations in cell envelope-related genes .

  • Intracellular adaptation: During infection of RAW 264.7 macrophages, B. melitensis demonstrates time-dependent changes in gene expression that reflect adaptation to the intracellular environment. Cell wall modification appears to be a key aspect of this adaptation process .

  • Immune evasion: Modifications in peptidoglycan structure, potentially involving mtgA activity, may contribute to the bacterium's ability to evade host immune recognition.

  • Persistent infection: B. melitensis can establish chronic infections, and the subacute-chronic progression of brucellosis may be influenced by cell wall remodeling enzymes like mtgA .

The infection model for studying these processes typically involves:

  • Mouse macrophage cell line RAW 264.7 maintained at 37°C with 5% CO₂

  • RPMI 1640 media supplemented with 10% bovine growth serum and 0.2 mM L-glutamine

  • Bacterial infection at MOI of 100

  • Gentamicin treatment (30 μg/mL) to eliminate extracellular bacteria

  • Sampling at multiple timepoints (4, 8, 24, and 48 hours post-infection)

How can structural knowledge of mtgA inform the development of novel antimicrobials?

As antimicrobial resistance continues to emerge in B. melitensis, understanding the structural aspects of mtgA offers opportunities for targeted drug development:

  • Active site targeting: The catalytic domain of mtgA contains conserved residues essential for glycosyltransferase activity. Small molecule inhibitors designed to interact with these residues could potentially disrupt peptidoglycan synthesis.

  • Allosteric inhibition: Beyond the active site, identifying allosteric sites that regulate mtgA activity could provide alternative targets for inhibitor design.

  • Protein-protein interaction disruption: Given mtgA's interactions with divisome components (PBP3, FtsW, FtsN), compounds that disrupt these protein-protein interactions could interfere with coordinated cell wall synthesis during division .

  • Species-specific targeting: Identifying structural features unique to B. melitensis mtgA compared to human or commensal bacterial enzymes could enable selective targeting while minimizing side effects.

  • Combination therapy approaches: Understanding how mtgA functions within the broader context of cell wall synthesis could inform rational combination therapies that target multiple steps in peptidoglycan assembly.

What are the optimal conditions for expressing and purifying recombinant B. melitensis mtgA?

Successful expression and purification of recombinant B. melitensis mtgA requires attention to several critical factors:

Expression System Selection:

  • E. coli BL21(DE3) is commonly used for initial expression attempts

  • Alternative systems include cell-free expression systems for potentially toxic membrane proteins

Expression Construct Design:

  • Include an N-terminal cleavable tag (His6 or MBP) to facilitate purification

  • Consider removing the transmembrane domain for improved solubility

  • GFP fusion constructs have demonstrated successful expression and functional activity

Expression Conditions:

  • Induction at lower temperatures (16-20°C) often improves folding of membrane-associated proteins

  • IPTG concentration between 0.1-0.5 mM typically provides balanced expression

  • Extended expression periods (overnight) at reduced temperatures may enhance yield

Purification Strategy:

  • Initial capture via affinity chromatography (Ni-NTA for His-tagged constructs)

  • Ion exchange chromatography for further purification

  • Size exclusion chromatography as a final polishing step

  • Consider including detergents (0.5% decyl-polyethylene glycol or similar) to maintain solubility of membrane-associated domains

Activity Preservation:

  • Addition of 10-15% glycerol to storage buffers improves stability

  • Storage at -80°C in small aliquots prevents repeated freeze-thaw cycles

  • Inclusion of reducing agents (1-5 mM DTT or β-mercaptoethanol) can preserve cysteine residues

How can the glycosyltransferase activity of mtgA be reliably measured in vitro?

Several established protocols enable reliable quantification of mtgA glycosyltransferase activity:

Radioactive Assay:

  • Substrate: 14C-GlcNAc-labeled lipid II (approximately 9,180 dpm/nmol)

  • Reaction buffer: 50 mM HEPES (pH 7.0), 10 mM CaCl₂

  • Solubilizing agents: 15% dimethyl sulfoxide, 10% octanol, 0.5% decyl-polyethylene glycol

  • Detection: Separation of products by thin-layer chromatography followed by autoradiography or scintillation counting

Fluorescence-Based Assay:

  • Substrate: Dansyl-labeled lipid II analogs

  • Detection: Continuous monitoring of fluorescence changes during polymerization

  • Advantages: Real-time kinetics, non-radioactive

HPLC Analysis:

  • Analysis of reaction products by HPLC separation

  • Detection of muropeptides following enzymatic digestion

  • Provides detailed information about product structure

Enzymatic Coupled Assay:

  • Monitoring release of pyrophosphate during glycan chain extension

  • Coupling to secondary enzymatic reactions with colorimetric readouts

  • Advantages: Continuous monitoring, adaptable to high-throughput screening

Validation Controls:

  • Positive control: Known active glycosyltransferase (such as E. coli PBP1b)

  • Negative control: Heat-inactivated enzyme

  • Specificity control: Lysozyme digestion of products (should completely digest polymerized material)

What cellular models are most appropriate for studying mtgA function in the context of B. melitensis infection?

Several cellular models provide valuable insights into mtgA function during infection:

Macrophage Infection Models:

  • RAW 264.7 mouse macrophage cell line: Established model for studying B. melitensis infection with standardized protocols

  • Primary bone marrow-derived macrophages (BMDMs): Closer to in vivo conditions, but with greater variability

  • THP-1 human monocytic cell line: Relevant for human host interactions

  • J774A.1 murine macrophage line: Alternative model with similar characteristics to RAW 264.7

Infection Protocol Parameters:

  • MOI optimization: Typically 100:1 bacteria:cell ratio

  • Infection time: 90 minutes for initial uptake

  • Gentamicin treatment: 30 μg/mL for 30 minutes to eliminate extracellular bacteria

  • Maintenance concentration: 2 μg/mL gentamicin to prevent extracellular growth

  • Time points: 4, 8, 24, and 48 hours post-infection for comprehensive analysis

Alternative Models:

  • Epithelial cell lines: HeLa or Caco-2 for studying alternative infection routes

  • Trophoblast models: For investigating placental infection mechanisms

  • Explant tissue cultures: For closer approximation of tissue architecture

  • 3D cell culture systems: To better represent tissue microenvironments

In Vivo Models:

  • Mouse models: BALB/c mice for acute infection studies

  • Chronic infection models: C57BL/6 mice for persistent infection

  • Specialized models: Pregnant mouse models for reproductive tract tropism

How should contradictory results in mtgA functional studies be interpreted?

Contradictory results in mtgA research may arise from several factors that require careful consideration:

Strain Background Effects:
The genetic background of bacterial strains significantly impacts mtgA function and localization. For example, mtgA localization at division sites was observed in the EJ801 strain (ponA(ts) ponB) but not in BW25113-derived strains. When plasmid pDML924 (expressing PBP1b) was introduced into EJ801, mtgA localization was no longer observed, indicating that localization depends on reduced competition with Class A PBPs .

To address strain background effects:

  • Document complete strain genotypes, including relevant mutations (dacA, dacB, etc.)

  • Perform complementation studies to confirm phenotype-genotype relationships

  • Consider constructing isogenic strains that differ only in the gene of interest

  • Include multiple reference strains when possible

Methodological Variations:
Different experimental approaches may yield seemingly contradictory results:

  • Protein-protein interactions detected in overexpression systems may not reflect physiological interactions

  • In vitro activity may differ from in vivo function

  • Fluorescent protein fusions can sometimes alter protein localization or function

Contextual Considerations:
mtgA function appears to be highly context-dependent:

  • Growth phase effects: Expression and localization patterns change throughout the bacterial life cycle

  • Environmental conditions: Media composition, pH, and osmolarity affect cell wall synthesis

  • Infection state: Intracellular environment induces distinct gene expression patterns

What are the current limitations in understanding mtgA's role in B. melitensis?

Despite significant advances, several important limitations remain in our understanding of B. melitensis mtgA:

Technical Limitations:

  • Challenges in working with B. melitensis under BSL3 conditions restrict certain experimental approaches

  • Limited availability of genetic tools compared to model organisms

  • Difficulties in obtaining high-resolution structural data for membrane-associated proteins

Knowledge Gaps:

  • The precise timing and regulation of mtgA activity during the B. melitensis cell cycle remains unclear

  • The complete set of protein interactions involving mtgA has not been comprehensively mapped

  • The specific contribution of mtgA to antimicrobial resistance phenotypes is not fully characterized

  • Host factors that may modulate mtgA activity during infection are largely unknown

Methodological Challenges:

  • Difficulties in distinguishing the specific contribution of mtgA from other glycosyltransferases

  • Complexity in interpreting gene expression data during infection due to host-pathogen interactions

  • Limited animal models that fully recapitulate human brucellosis pathogenesis

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.