Recombinant Brucella melitensis biotype 1 NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Biological Function

NuoK is a subunit of the NDH-1 complex, a key enzyme in the bacterial respiratory chain. Its primary roles include:

  • Electron Transport: Facilitates the transfer of electrons from NADH to ubiquinone, generating a proton gradient across the membrane .

  • Proton Translocation: Couples redox reactions to proton pumping, conserving energy for ATP synthesis .

  • Pathogen Survival: In Brucella melitensis, NDH-1 contributes to intracellular survival by modulating host cell metabolism, including mitochondrial function .

Research Applications

This recombinant protein is utilized in diverse studies:

Pathogenicity and Host Interaction

  • Virulence Studies: NuoK’s role in energy metabolism may influence Brucella’s ability to replicate within host cells, particularly in mitochondrial-like compartments .

  • Type IV Secretion System (T4SS) Interaction: While not directly a T4SS effector, nuoK’s association with mitochondrial processes may indirectly support Brucella’s evasion of host immune responses .

Vaccine and Diagnostic Development

  • Antigen Targeting: Serves as a candidate antigen for serological assays (e.g., ELISA) to distinguish Brucella-infected from vaccinated animals .

  • Rough Strain Analysis: Mutations in genes like manBcore (linked to lipopolysaccharide biosynthesis) in rough Brucella strains highlight the need for alternative antigens like nuoK .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
nuoK; BMEI1148; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)
Target Names
nuoK
Target Protein Sequence
MEIGIAHYLTVSAILFTLGVFGIFLNRKNVIVILMSIELILLSVNLNFVAFSSQLGDLVG QVFALFVLTVAAAEAAIGLAILVVFFRNRGSIAVEDVNVMKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones in the respiratory chain via FMN and iron-sulfur (Fe-S) centers. In this organism, ubiquinone is believed to be the primary electron acceptor. This redox reaction is coupled to proton translocation, where four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred, thus conserving energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of NADH-quinone oxidoreductase subunit K (nuoK) in Brucella melitensis metabolism?

NADH-quinone oxidoreductase subunit K (nuoK) is a component of Complex I in the electron transport chain of B. melitensis. This protein plays a critical role in the bacterial respiratory chain, facilitating electron transfer from NADH to quinones and contributing to the proton motive force necessary for ATP synthesis. In B. melitensis, as in other bacteria, the respiratory chain components are essential for energy metabolism, particularly under oxygen-limited conditions that may be encountered during infection. The nuoK subunit appears to be conserved across various Brucella species and biotypes, suggesting its functional importance .

How does B. melitensis biotype 1 differ from other biotypes in terms of virulence and tissue colonization?

B. melitensis exhibits biotype variation that affects virulence and host interaction patterns. Biotype 1 strains have demonstrated extensive tissue colonization capabilities compared to other biotypes. In experimental infections, B. melitensis has been isolated from multiple tissues, including lymph nodes, spleen, liver, and reproductive organs. A recent study found that virulent B. melitensis (strain 16M) disseminated widely in pregnant goats with none of 15 sampled tissues spared from colonization, including the first reported isolation from muscle tissue in ruminants .

Biotype classification is traditionally based on biochemical and serological characteristics. According to genomic analysis of 189 B. melitensis strains, significant diversity exists even within biotypes, with evidence showing 14 strains in biotype 1, 145 in biotype 3, and 30 variant strains . This diversity may account for differences in pathogenicity and host adaptation.

What is the general approach for producing recombinant proteins from B. melitensis?

The production of recombinant proteins from B. melitensis typically follows these methodological steps:

  • Gene identification and isolation: Using genomic data to identify the target gene sequence (e.g., nuoK) and designing primers for amplification.

  • Cloning: The amplified gene is inserted into an expression vector, often containing tags for purification (His-tag, GST, etc.).

  • Expression: Transformation into an expression host (commonly E. coli BL21 or similar strains) followed by induction of protein expression.

  • Purification: Using affinity chromatography based on the fusion tag, followed by additional purification steps as needed.

  • Verification: SDS-PAGE, Western blot, and mass spectrometry to confirm identity and purity.

This general approach has been successfully used for other B. melitensis proteins, such as the 31-kDa outer membrane protein (Omp31), which demonstrated immunogenic properties when administered with adjuvants .

What expression systems are most effective for producing recombinant B. melitensis nuoK protein?

When selecting an expression system for recombinant B. melitensis nuoK, researchers should consider several factors based on the protein's characteristics and research objectives:

Table 1: Comparison of Expression Systems for Recombinant Brucella Proteins

Expression SystemAdvantagesLimitationsSuitability for nuoK
E. coliHigh yield, rapid growth, economical, multiple vector optionsLimited post-translational modifications, potential for inclusion bodies with membrane proteinsMay require optimization for membrane protein expression; detergents often needed
Yeast (P. pastoris)Eukaryotic post-translational modifications, secretion capabilityLonger development time, glycosylation patterns differ from mammalsGood for soluble domains but may be challenging for full-length nuoK
Mammalian cellsNative-like folding and modificationsExpensive, lower yields, technical complexityBest for studying interaction with host factors but impractical for large-scale production
Cell-free systemsAvoids toxicity issues, rapid expressionExpensive, limited scaleUseful for initial characterization studies

For membrane proteins like nuoK, E. coli systems using specialized strains (C41, C43) and vectors designed for membrane proteins (pET-based with regulatory elements) often provide the best balance of yield and functionality. Fusion partners like MBP (maltose-binding protein) can enhance solubility .

How can researchers optimize the purification of recombinant nuoK to maintain protein functionality?

Purification of functional recombinant nuoK requires specialized approaches due to its membrane-associated nature:

  • Membrane extraction: Use mild detergents (DDM, LDAO, or Triton X-100) at concentrations just above their critical micelle concentration to solubilize the protein while maintaining native structure.

  • Optimized buffer conditions:

    • pH range: 7.0-8.0 (typical for B. melitensis proteins)

    • Salt concentration: 150-300 mM NaCl to maintain stability

    • Include glycerol (10-20%) to prevent aggregation

    • Consider adding reducing agents (1-5 mM DTT or β-mercaptoethanol) if the protein contains cysteine residues

  • Chromatography strategy:

    • Initial capture: IMAC (immobilized metal affinity chromatography) if His-tagged

    • Intermediate purification: Ion exchange chromatography

    • Polishing: Size exclusion chromatography with detergent-containing mobile phase

  • Functional verification: Assess NADH dehydrogenase activity using spectrophotometric assays measuring the reduction of artificial electron acceptors like ferricyanide or dichloro-indophenol (DCIP) .

What are the most reliable methods for assessing the immunogenicity of recombinant B. melitensis proteins like nuoK?

Based on established protocols for B. melitensis immunogenicity studies, the following methodological approaches are recommended for assessing recombinant nuoK:

  • In vitro assessment:

    • Antibody response measurement: ELISA for detecting specific IgG and IgM antibodies, as demonstrated in studies of B. melitensis infections where IgG titers reached 252-311 U/ml in infected individuals

    • T-cell activation assays: Measuring proliferation and cytokine production (IFN-γ, IL-2) by splenocytes or peripheral blood mononuclear cells after stimulation with the recombinant protein

    • Cytotoxic T-lymphocyte (CTL) activity: Specific lysis of target cells expressing the protein

  • In vivo assessment:

    • Animal immunization: Using adjuvants like incomplete Freund's adjuvant as used with other B. melitensis proteins

    • Challenge studies: Protection assessment against virulent B. melitensis strains (e.g., 16M)

    • Cytokine profile analysis: Determining Th1/Th2 balance through cytokine quantification

Studies with other B. melitensis proteins, such as Omp31, have shown successful induction of both humoral and cell-mediated immune responses, with higher IgG1 than IgG2 titers and significant production of Th1 cytokines (IL-2 and IFN-γ) without IL-10 or IL-4 production .

How might nuoK contribute to B. melitensis metabolic adaptation during infection?

The NADH-quinone oxidoreductase complex plays a crucial role in bacterial adaptation to changing environments during infection. For nuoK specifically:

  • Metabolic flexibility: As part of Complex I, nuoK likely contributes to B. melitensis' ability to adapt to oxygen-limited environments encountered within host cells. Transcriptional profiling studies have shown that B. melitensis modifies its metabolic gene expression during intracellular phases of infection .

  • Energy harvesting efficiency: The nuoK subunit may influence the efficiency of proton translocation across the membrane, potentially affecting ATP production during nutrient-limited conditions inside phagocytes.

  • Redox balance maintenance: By participating in electron transport, nuoK could help maintain cellular redox balance when B. melitensis faces oxidative stress during infection.

  • Temporal expression patterns: Transcriptomic studies have revealed distinct gene expression profiles at different infection stages. B. melitensis shows a common down-regulation transcriptional profile at 4 hours post-infection that reverses at 12 hours post-infection, suggesting metabolic adaptation to the intracellular environment .

Understanding nuoK's role in these processes could provide insights into how B. melitensis manages energy production during different stages of infection and in various host tissues.

What is the potential of recombinant nuoK as a component in subunit vaccines against B. melitensis?

Based on research with other B. melitensis proteins, recombinant nuoK may have potential as a vaccine component, though with specific considerations:

  • Immunogenicity assessment: While membrane proteins can be highly immunogenic, nuoK's effectiveness would need to be evaluated compared to established immunogens like Omp31, which has demonstrated protection against B. melitensis and B. ovis infections .

  • Protection mechanism: If nuoK induces a strong Th1 response with CD4+ T cell activation and IFN-γ production, similar to Omp31, it may contribute to protective immunity. Studies with Omp31 showed that it induced specific cytotoxic T-lymphocyte activity leading to in vitro lysis of Brucella-infected cells .

  • Combination strategies: Rather than using nuoK alone, a multi-subunit approach combining nuoK with other immunogenic proteins might provide broader protection. Research has shown that even peptide fragments (27-aa) derived from Brucella proteins can induce protection similar to whole recombinant proteins .

  • Delivery considerations: The hydrophobic nature of nuoK may require special formulation approaches, such as liposomal delivery or use of stronger adjuvants to enhance immune recognition.

  • Cross-protection potential: Evaluation against multiple Brucella species and biotypes would be necessary, considering the genetic diversity observed among B. melitensis strains .

How can genomic and transcriptomic analyses enhance our understanding of nuoK function in different B. melitensis lineages?

Integrating genomic and transcriptomic approaches provides powerful insights into nuoK function across B. melitensis lineages:

  • Comparative genomics: Analysis of nuoK sequence conservation across the 19 sequence types (STs) identified in phylogenetic studies of B. melitensis can reveal selective pressures on this gene. Recent whole genome sequencing of 189 B. melitensis strains identified two major clades (A and B) with clade B containing 18 sequence types, suggesting considerable genetic diversity that may extend to metabolic genes like nuoK .

  • Expression profiling under different conditions:

    • Host infection models: Transcriptomic studies have demonstrated that B. melitensis shows distinct expression patterns at different infection timepoints (4h vs. 12h), suggesting temporal regulation of metabolic genes during infection .

    • Environmental stressors: Comparing nuoK expression under various stress conditions (oxygen limitation, pH stress, nutrient depletion) can clarify its role in adaptation.

    • Tissue-specific expression: Given that B. melitensis colonizes diverse tissues, from lymph nodes to muscle , tissue-specific expression patterns of nuoK may indicate specialized metabolic adaptations.

  • Regulatory network mapping: Identifying transcription factors and regulatory elements controlling nuoK expression through ChIP-seq or similar techniques.

  • Integration with proteomics: Correlating nuoK mRNA levels with protein abundance and post-translational modifications to understand regulatory mechanisms.

  • Functional validation through gene editing: Using techniques like CRISPR interference (CRISPRi) to modulate nuoK expression and observe phenotypic effects in different lineages.

What are the main challenges in expressing and purifying membrane proteins like nuoK from B. melitensis?

Membrane proteins like nuoK present several methodological challenges:

  • Toxicity to expression hosts: Overexpression of membrane proteins can disrupt host cell membrane integrity, leading to growth inhibition or cell death.

    • Solution: Use tightly regulated expression systems (e.g., T7lac or arabinose-inducible) and lower induction temperatures (16-25°C).

  • Poor solubility and inclusion body formation: Hydrophobic domains tend to aggregate during expression.

    • Solution: Fusion tags like MBP or SUMO can enhance solubility; alternatively, inclusion bodies can be isolated and refolded under controlled conditions.

  • Maintaining native structure: Detergent selection critically impacts protein folding and activity.

    • Solution: Screen multiple detergents (DDM, LDAO, CHAPS) and lipid-like environment providers (nanodiscs, amphipols) to optimize solubilization conditions.

  • Low yield: Membrane proteins typically express at lower levels than soluble proteins.

    • Solution: Scale-up strategies and specialized expression strains like C41(DE3) and C43(DE3) designed for membrane protein expression.

  • Functional assessment challenges: Traditional activity assays may be difficult to perform in detergent-solubilized states.

    • Solution: Reconstitution into proteoliposomes or nanodiscs to create a membrane-like environment for functional studies.

Research with other Brucella proteins has shown that optimization of expression conditions, including growth media composition and induction parameters, can significantly improve yields of functional recombinant proteins .

How can researchers effectively evaluate the role of nuoK in B. melitensis pathogenesis?

To evaluate nuoK's role in B. melitensis pathogenesis, researchers should employ multiple complementary approaches:

  • Gene knockout or knockdown studies:

    • Conditional mutants: If nuoK is essential, use inducible systems to control expression levels

    • CRISPRi: For transient reduction of expression without genomic modification

    • Phenotypic assessment: Compare growth, survival, and virulence between wild-type and nuoK-deficient strains

  • Infection models:

    • Cell culture systems: Assess intracellular survival and replication in professional phagocytes and non-phagocytic cells

    • Animal models: The pregnant goat model has been well-characterized for B. melitensis, with documented patterns of tissue colonization

    • Assessment criteria: Tissue bacterial burden, dissemination patterns, and host immune response

  • Host response evaluation:

    • Transcriptomics: Analyze host cell responses to wild-type versus nuoK-deficient strains

    • Immunological markers: Measure cytokine profiles, particularly Th1-associated cytokines (IFN-γ, IL-2) that are critical for controlling Brucella infection

    • Serological responses: Monitor antibody development patterns, as serological responses to B. melitensis can vary (median time to seroconversion: 21 days)

  • Complementation studies:

    • Trans-complementation: Reintroduce wild-type or mutant nuoK variants to confirm phenotype specificity

    • Heterologous complementation: Test functional equivalence with orthologous proteins from other species

  • Metabolic flux analysis:

    • Respiratory capacity measurement: Compare oxygen consumption rates between wild-type and nuoK-modified strains

    • Metabolomics: Profile metabolite changes to understand downstream effects of nuoK modification

What bioinformatic approaches can identify potential functional domains and interactions of nuoK across Brucella species?

Comprehensive bioinformatic analysis of nuoK should include:

  • Sequence-based analyses:

    • Multiple sequence alignment: Compare nuoK across Brucella biotypes and species to identify conserved regions

    • Phylogenetic profiling: Trace evolutionary relationships of nuoK among the 19 sequence types of B. melitensis identified through whole genome sequencing

    • Structural prediction: Use tools like AlphaFold2 to predict membrane topology and secondary structure elements

  • Functional domain prediction:

    • Transmembrane domain analysis: Tools like TMHMM or Phobius to map membrane-spanning regions

    • Conserved motif identification: PROSITE or MEME to identify functional signatures

    • Protein family classification: Pfam and InterPro to place nuoK in its functional context within the NADH-quinone oxidoreductase complex

  • Protein-protein interaction prediction:

    • Co-evolution analysis: Methods like Direct Coupling Analysis (DCA) to identify residues that co-evolve, suggesting interaction interfaces

    • Docking simulations: Model interactions with other subunits of the NADH-quinone oxidoreductase complex

    • Integration with experimental data: Incorporate cross-linking mass spectrometry data or bacterial two-hybrid results if available

  • Comparative genomics approaches:

    • Synteny analysis: Examine gene neighborhood conservation across species

    • Expression correlation: Identify genes with similar expression patterns in transcriptomic datasets

    • Regulatory element prediction: Identify potential transcription factor binding sites in the nuoK promoter region

  • Systems biology integration:

    • Pathway analysis: Map nuoK in the context of B. melitensis metabolic networks

    • Host-pathogen interaction predictions: Identify potential interactions with host factors based on structural similarities to known interaction partners

How might structural biology approaches enhance our understanding of nuoK function in B. melitensis?

Advanced structural biology techniques could provide critical insights into nuoK function:

  • Cryo-electron microscopy (cryo-EM):

    • Determine the structure of the entire NADH-quinone oxidoreductase complex with nuoK in its native context

    • Visualize conformational changes during electron transport and proton pumping

    • Resolution at near-atomic level without the need for crystallization

  • X-ray crystallography:

    • Obtain high-resolution structures of nuoK domains or stabilized full-length protein

    • Co-crystallization with inhibitors or substrate analogs to understand binding mechanisms

    • Identify structural features unique to Brucella nuoK compared to homologs

  • Nuclear magnetic resonance (NMR) spectroscopy:

    • Analyze dynamics of specific regions of nuoK in membrane-mimetic environments

    • Study interactions with other subunits or small molecules

    • Characterize structural changes in response to environmental conditions

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Map conformational dynamics and solvent accessibility

    • Identify regions involved in complex assembly or substrate interactions

    • Less demanding in terms of protein quantity than crystallography

  • In silico molecular dynamics:

    • Simulate nuoK behavior in lipid bilayers under various conditions

    • Model electron transfer pathways and proton translocation mechanisms

    • Predict effects of mutations on protein stability and function

What is the potential for identifying nuoK inhibitors as novel therapeutics against B. melitensis infection?

The development of nuoK inhibitors represents a promising therapeutic strategy:

  • Target validation considerations:

    • Essentiality assessment: Determine if nuoK is essential for B. melitensis survival, particularly during infection

    • Specificity potential: Compare with human homologs to identify Brucella-specific features

    • Metabolic vulnerability: Assess whether nuoK inhibition creates metabolic bottlenecks that cannot be bypassed

  • High-throughput screening approaches:

    • Biochemical assays: Measure NADH oxidation or artificial electron acceptor reduction

    • Whole-cell screens: Identify compounds that specifically inhibit B. melitensis growth

    • Membrane potential assays: Detect compounds that collapse proton gradients

  • Structure-based drug design strategies:

    • Virtual screening against predicted binding pockets

    • Fragment-based approaches to develop lead compounds

    • Rational design based on substrate or cofactor analogs

  • Therapeutic considerations:

    • Compound delivery across bacterial membranes

    • Activity in intracellular environments where B. melitensis resides

    • Combination with existing treatments (e.g., streptomycin, which is used in current treatments)

  • Resistance development assessment:

    • Frequency of resistance mutations

    • Cross-resistance with existing antibiotics

    • Fitness cost of resistance mutations

Given that current treatments for brucellosis involve prolonged antibiotic therapy and risk of relapse, novel targets in critical metabolic pathways like electron transport could provide valuable therapeutic alternatives.

How can systems biology approaches integrate nuoK function into the broader context of B. melitensis metabolism during infection?

Systems biology offers powerful frameworks to contextualize nuoK function:

Such integrated approaches would place nuoK within its functional context and reveal how respiratory chain components contribute to B. melitensis' remarkable ability to adapt to diverse host environments during infection.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.