Recombinant Brucella melitensis biotype 1 Phosphatidate cytidylyltransferase (cdsA)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Brucella melitensis biotype 1 Phosphatidate cytidylyltransferase (cdsA) is a genetically engineered enzyme produced by inserting the cdsA gene from B. melitensis into a heterologous expression system, typically Escherichia coli. This enzyme catalyzes the conversion of phosphatidic acid (PA) to CDP-diacylglycerol (CDP-DAG), a critical step in phospholipid biosynthesis essential for bacterial membrane formation and virulence .

Functional Role in Brucella melitensis

cdsA is a key enzyme in the Kennedy pathway, responsible for synthesizing CDP-DAG, a precursor for phosphatidylglycerol (PG), cardiolipin (CL), and other phospholipids. These lipids are vital for:

  • Membrane integrity and curvature

  • Protein localization and signaling

  • Adaptation to intracellular niches during infection .

Biochemical Studies

Recombinant cdsA is used to:

  • Characterize enzymatic kinetics (e.g., CTP/PA binding affinity)

  • Screen inhibitors targeting phospholipid biosynthesis in Brucella .

Antimicrobial Resistance (AMR) Research

Genomic analyses of B. melitensis strains highlight mutations in metabolic genes (e.g., rpoB, efflux pumps), though cdsA itself is not yet linked to AMR .

Comparative Analysis with Homologs

FeatureB. melitensis cdsAStaphylococcus aureus cdsA
Length (aa)305260
Host SpecificityRuminants/humansHumans
Key DomainsCytidylyltransferaseCytidylyltransferase
Expression SystemE. coliE. coli

Source:

Limitations and Future Directions

  • No peer-reviewed studies directly evaluate cdsA’s role in Brucella pathogenesis or vaccine efficacy.

  • Potential areas for research include structural characterization, host-pathogen interaction studies, and high-throughput inhibitor screening.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1–1.0 mg/mL. We recommend adding 5–50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is finalized during production. If you require a particular tag, please specify this in your order; we will prioritize your request.
Synonyms
cdsA; BMEI0828; Phosphatidate cytidylyltransferase; CDP-DAG synthase; CDP-DG synthase; CDP-diacylglycerol synthase; CDS; CDP-diglyceride pyrophosphorylase; CDP-diglyceride synthase; CTP:phosphatidate cytidylyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)
Target Names
cdsA
Target Protein Sequence
MSNLQTRIITAIVLGTITLWLTWVGGVGFTLFSIAIGLAMFYEWTELSATRQTAFSRLFG WAWLIVTGILLILDRGALLTIGFLVAGCAILLVTQWKSGRGWPAAGLFYAGFSALSLSLL RGDEPFGFTTIVFLFAVVWSTDIAAYFNGRALGGPKLAPRFSPNKTWSGAIGGAAAAVTG GLLVASLVAAPGGWGVPVLALLLSIVSQIGDLAESWVKRQFGAKDSGRLLPGHGGVLDRV DGLVAAAALLYLFGAIFAEPDVPSAIFFSF
Uniprot No.

Target Background

Database Links
Protein Families
CDS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of Phosphatidate cytidylyltransferase (cdsA) in Brucella melitensis?

Phosphatidate cytidylyltransferase (cdsA) is an essential enzyme (EC 2.7.7.41) in Brucella melitensis that catalyzes the formation of CDP-diacylglycerol from phosphatidate (phosphatidic acid) and CTP, a critical step in phospholipid biosynthesis. The protein consists of 250 amino acid residues with a molecular weight of approximately 28 kDa . The amino acid sequence reveals several transmembrane domains, indicating its association with bacterial membranes . Analysis of the B. melitensis genome indicates that cdsA is encoded on one of its two circular chromosomes, which together comprise 3,294,935 bp encoding 3,197 ORFs in total . The enzyme's structure includes multiple hydrophobic regions consistent with its membrane localization and lipid substrate interaction capability.

How does the amino acid sequence of B. melitensis cdsA compare with orthologs in other bacterial species?

The amino acid sequence of B. melitensis biotype 1 Phosphatidate cytidylyltransferase (UniProt ID: Q8YHH2) shows significant conservation in catalytic domains when compared to orthologs in other α-proteobacteria . The protein contains the characteristic sequence MSNLQTRIITAIVLGTITLWLTWVGGVGFTLFSIAIGLAMFYEWTELSATRQTAFSRLFGWAWLIVTGILLILDRGALLTIGFLVAGCAILLVTQWKSGRGWPAAGLFYAGFSALSLSLLRGDEPFGFTTIVFLFAVVWSTDIAAYFNGRALGGPKLAPRFSPNKTWSGAIGGAAAAVTGGLLVASLVAAPGGWGVPVLALLLSIVSQIGDLAESWVKRQFGAKDSGRLLPGHGGVLDRVDGLVAAAALLYLFGAIFAEPDVPSAIFFSF . Comparative analysis reveals evolutionary relationships with similar enzymes in Sinorhizobium meliloti, reflecting the phylogenetic proximity of these species . This conservation extends particularly to the catalytic domains responsible for binding CTP and phosphatidate, while membrane-spanning regions show greater sequence divergence.

What are the established methods for expressing and purifying recombinant B. melitensis cdsA for research purposes?

Expression of recombinant B. melitensis cdsA typically employs prokaryotic expression systems, particularly E. coli BL21(DE3) or similar strains harboring expression vectors with inducible promoters. The procedure involves:

  • Cloning: The cdsA gene (accession Q8YHH2) is PCR-amplified from B. melitensis 16M genomic DNA and cloned into an expression vector (pET series commonly used) .

  • Expression optimization: Due to its multiple transmembrane domains, expression is optimized by:

    • Induction at lower temperatures (16-20°C)

    • Using reduced IPTG concentrations (0.1-0.5 mM)

    • Extending induction periods (16-24 hours)

  • Purification: As a membrane protein, purification requires:

    • Cell lysis using sonication or pressure-based methods

    • Membrane fraction isolation through ultracentrifugation

    • Solubilization with detergents (DDM, CHAPS, or Triton X-100)

    • Affinity chromatography using appropriate tags (His-tag commonly employed)

    • Size exclusion chromatography for final purification

The protein is typically stored in Tris-based buffer with 50% glycerol at -20°C to maintain stability . Repeated freeze-thaw cycles should be avoided, with working aliquots stored at 4°C for up to one week.

What assays are available to measure the enzymatic activity of recombinant cdsA from B. melitensis?

Enzymatic activity of recombinant Phosphatidate cytidylyltransferase can be measured using several complementary approaches:

  • Radioisotope-based assay: Utilizing [14C]phosphatidic acid or [3H]CTP as substrates, followed by thin-layer chromatography separation and scintillation counting of CDP-diacylglycerol formation.

  • Coupled enzyme assay: Measuring pyrophosphate (PPi) release during the reaction using pyrophosphatase to convert PPi to phosphate, which is then quantified colorimetrically using malachite green.

  • HPLC-based assay: Directly measuring CDP-diacylglycerol formation using reverse-phase HPLC with appropriate lipid separation columns.

  • Mass spectrometry: Using LC-MS/MS to detect and quantify reaction products with high specificity.

The optimal assay conditions include:

  • pH 7.0-7.5 (typically in HEPES or Tris buffer)

  • Presence of divalent cations (5-10 mM Mg2+)

  • Detergent at concentrations above CMC but below inhibitory levels

  • Temperature of 30-37°C

  • CTP and phosphatidic acid at concentrations of 0.1-1 mM

How does the enzymatic activity of cdsA contribute to Brucella melitensis pathogenesis?

Phosphatidate cytidylyltransferase plays a critical role in B. melitensis pathogenesis through several mechanisms:

  • Membrane biogenesis: As a key enzyme in phospholipid biosynthesis, cdsA is essential for bacterial membrane integrity and composition, which directly affects the pathogen's ability to survive within host cells .

  • Intracellular survival: B. melitensis establishes intracellular niches within phagocytic and non-phagocytic cells. The formation of the Brucella-containing vacuole requires extensive membrane remodeling, a process dependent on phospholipid biosynthesis pathways involving cdsA .

  • Virulence factor secretion: The type IV secretion system of B. melitensis, essential for virulence, requires proper membrane composition for assembly and function . cdsA indirectly supports this by maintaining phospholipid homeostasis.

  • Resistance to host defense mechanisms: Proper membrane composition confers resistance to host antimicrobial peptides and oxidative stress within macrophages .

  • Modulation of host response: Bacteria-derived phospholipids may interfere with host cell signaling pathways, potentially modulating immune responses .

Transcriptomic studies have shown alteration in expression of genes involved in membrane biogenesis, including phospholipid biosynthesis pathways, during macrophage infection, suggesting their importance during adaptation to the intracellular environment .

What inhibitors of B. melitensis cdsA have been identified, and how do they affect bacterial viability?

Research on specific inhibitors of B. melitensis cdsA is limited, but several compounds targeting phosphatidate cytidylyltransferase have shown antimicrobial potential:

  • Nucleotide analogs: Modified CTP analogs that compete for the nucleotide binding site.

  • Phosphatidate mimetics: Compounds structurally similar to phosphatidic acid that compete for substrate binding.

  • Membrane-targeting compounds: Some antimicrobials may indirectly affect cdsA activity by disrupting its membrane environment.

Inhibition of cdsA typically leads to:

  • Disruption of phospholipid biosynthesis

  • Membrane integrity compromise

  • Reduced bacterial viability, especially under stress conditions

  • Impaired intracellular survival

Recent antimicrobial resistance studies in B. melitensis have not identified mutations in cdsA associated with resistance to conventional antibiotics, suggesting this pathway remains a potentially exploitable target . The absence of this pathway in mammalian cells (which use a different route for phosphatidylcholine synthesis) makes it an attractive target for selective antimicrobial development.

How can recombinant cdsA be used for developing serological diagnostics for brucellosis?

Recombinant cdsA can be employed for developing serological diagnostics for brucellosis through the following methodological approaches:

  • ELISA development:

    • Indirect ELISA: Recombinant cdsA is immobilized on plates to capture Brucella-specific antibodies from patient sera .

    • Competitive ELISA: Labeled antibodies compete with patient antibodies for binding to immobilized cdsA.

    Protocol optimization considerations:

    • Coating concentration: 1-5 μg/ml of purified recombinant cdsA

    • Blocking agents: BSA or casein to prevent non-specific binding

    • Sample dilution: Typically 1:100 to 1:400 for serum samples

    • Detection systems: HRP-conjugated secondary antibodies with appropriate substrates

  • Immunoblotting applications:

    • Western blot analysis using recombinant cdsA to detect specific antibodies

    • Dot blot assays for rapid screening

  • Multiplex assays:

    • Coupling recombinant cdsA with other Brucella immunogenic proteins (like Omp31) to increase sensitivity and specificity .

    • Protein microarrays incorporating multiple recombinant antigens

The diagnostic value depends on:

  • Expression of cdsA during in vivo infection

  • Immunogenicity in different host species

  • Cross-reactivity with proteins from other pathogens

  • Consistency of antibody responses across different disease stages

Preliminary studies suggest that combining multiple recombinant Brucella proteins, including membrane-associated enzymes like cdsA, provides higher sensitivity and specificity than single-antigen tests.

What is the optimal methodology for generating knockout or knockdown of cdsA in B. melitensis for functional studies?

For functional characterization through genetic manipulation of cdsA in B. melitensis, researchers can employ several complementary strategies:

  • Complete gene knockout:

    • Homologous recombination approach using suicide vectors (e.g., pJQ200 series)

    • CRISPR-Cas9 system adapted for Brucella

    • Protocol considerations:

      • Using antibiotic resistance cassettes flanked by 500-1000 bp homologous regions

      • Two-step selection process with positive (antibiotic) and negative (sucrose sensitivity) markers

      • Verification through PCR, sequencing, and Southern blot

  • Conditional knockdown systems:

    • Since cdsA may be essential, conditional approaches are preferred:

      • Tetracycline-inducible promoter replacement

      • Destabilizing domain fusion systems

      • CRISPRi using catalytically inactive Cas9 to repress transcription

  • Trans-complementation:

    • Reintroducing functional cdsA on plasmids (pBBR1MCS series)

    • Expressing under native or inducible promoters

    • Including epitope tags for localization and interaction studies

  • Point mutations:

    • Site-directed mutagenesis of key catalytic residues

    • Expression of dominant-negative variants

For verification of phenotypic effects, researchers typically assess:

  • Growth curves in different media

  • Membrane phospholipid composition by TLC or mass spectrometry

  • Intracellular survival in macrophage or epithelial cell infection models

  • Virulence in mouse models

Transcriptomic analysis has been successfully employed to study the effects of gene manipulation in B. melitensis, allowing for assessment of global changes resulting from cdsA modulation .

What cell-based infection models are most appropriate for studying the role of cdsA in B. melitensis pathogenesis?

Several cell-based infection models can be employed to study cdsA's role in B. melitensis pathogenesis, each with specific advantages:

  • Professional phagocytic cells:

    • RAW 264.7 or J774.A1 macrophages: Widely used for studying initial phagocytosis and intracellular trafficking

    • Primary bone marrow-derived macrophages (BMDMs): Provide more physiologically relevant conditions

    • THP-1 human monocytes: Useful for studying human-specific interactions

    Experimental parameters:

    • Multiplicities of infection (MOI): 10-100 bacteria per cell

    • Time points: 0.5, 4, 12, 24, 48 hours post-infection

    • Readouts: Intracellular bacterial counts, cytokine production, macrophage activation markers

  • Non-phagocytic cells:

    • HeLa cells: Used to study active invasion mechanisms

    • Trophoblasts: Relevant for understanding placental infections

    Key protocols:

    • Gentamicin protection assay to eliminate extracellular bacteria

    • Confocal microscopy to track intracellular trafficking

    • Assessment of Brucella-containing vacuole formation

  • Three-dimensional tissue models:

    • Placental explants: For reproductive tract tropism studies

    • Intestinal epithelium models: For studying initial invasion events

  • Ex vivo models:

    • Peyer's patches: For modeling initial intestinal invasion

    • Splenic tissue: For studying dissemination

Analytical approaches should include:

  • Transcriptional profiling of host and pathogen during infection

  • Phospholipid analysis of bacterial and vacuolar membranes

  • Immunofluorescence microscopy to track cdsA localization

  • Electron microscopy to assess membrane integrity

The calf ileal loop model has been validated for studying early Brucella-host interactions and could be particularly valuable for assessing the role of cdsA in initial invasion events .

How can recombinant cdsA be incorporated into vaccine development strategies against B. melitensis infection?

Integration of recombinant cdsA into vaccine development strategies against B. melitensis involves several methodological approaches:

  • Subunit vaccine formulations:

    • Adjuvant selection: Incomplete Freund's adjuvant has proven effective with other Brucella recombinant proteins . Alternative adjuvants including:

      • Aluminum salts for enhanced antibody responses

      • CpG oligonucleotides for Th1-biased immunity

      • Liposomes or nanoparticles for improved delivery

    • Multi-antigen combinations: Combining cdsA with established protective antigens like Omp31 :

      • Co-administration of separate proteins

      • Fusion protein constructs

      • Multi-epitope chimeric proteins

  • DNA vaccine approaches:

    • Plasmid constructs encoding cdsA under strong promoters

    • Prime-boost strategies combining DNA and protein immunization

    • Codon optimization for improved expression in mammalian cells

  • Vectored vaccines:

    • Using attenuated viral or bacterial vectors expressing cdsA

    • Potential vectors include adenovirus or attenuated Salmonella strains

    • Design considerations:

      • Promoter strength and codon usage

      • Inclusion of immunostimulatory sequences

      • Vector safety profile

  • Evaluation protocols:

    • Immune response assessment:

      • Antibody titers and isotype profiles

      • T-cell proliferation assays

      • Cytokine profiling (IFN-γ, IL-2, IL-4, IL-10)

      • Cytotoxic T-lymphocyte activity

    • Protection studies:

      • Mouse challenge models using virulent B. melitensis

      • Bacterial burden determination in spleen and liver

      • T-cell subset depletion to determine protective mechanisms

Research with other Brucella antigens suggests that protection is primarily mediated by CD4+ T cells, with CD8+ T cells playing a more limited role . Vaccine formulations should therefore aim to stimulate robust CD4+ Th1 responses.

What are the considerations for assessing cross-protection against different Brucella species when using cdsA-based immunization?

When evaluating cross-protection potential of cdsA-based immunization against diverse Brucella species, researchers should consider:

  • Sequence conservation analysis:

    • Comparative genomics reveals high conservation of cdsA across Brucella species

    • Epitope conservation should be specifically assessed between:

      • B. melitensis (cause of ovine/caprine brucellosis)

      • B. abortus (bovine brucellosis)

      • B. suis (swine brucellosis)

      • B. canis (canine brucellosis)

      • B. ovis (ram epididymitis)

  • Cross-protection experimental design:

    • Animal models:

      • BALB/c mice as primary model

      • Natural host challenge models where feasible

    • Challenge protocols:

      • Heterologous challenge with different Brucella species

      • Standardized infectious dose (typically 104-106 CFU)

      • Assessment timepoints (2-8 weeks post-challenge)

      • Organ colonization quantification (spleen, liver, lymph nodes)

  • Immunological cross-reactivity evaluation:

    • Humoral cross-reactivity:

      • ELISA using recombinant cdsA from different species

      • Western blot analysis for epitope recognition patterns

      • Antibody neutralization assays if applicable

    • Cellular cross-reactivity:

      • T-cell proliferation with heterologous antigens

      • Cytokine profiles in response to different species' antigens

      • CTL activity against macrophages infected with various species

  • Protection mechanisms comparison:

    • In vivo T-cell subset depletion in cross-protection models

    • Passive transfer of immune sera between species-specific challenges

    • Adoptive transfer of T-cells from immunized to naïve animals

How can structural biology approaches be applied to understand cdsA function and develop structure-based inhibitors?

Advanced structural biology approaches to elucidate cdsA function and develop structure-based inhibitors involve:

  • Protein structure determination:

    • X-ray crystallography:

      • Challenges: Membrane protein crystallization requires:

        • Detergent screening (DDM, LDAO, OG)

        • Lipidic cubic phase methods

        • Antibody fragment co-crystallization to stabilize structure

      • Resolution targets: 2.0-3.0 Å for detailed catalytic site visualization

    • Cryo-electron microscopy:

      • Single-particle analysis for higher-order structures

      • Recent advances enabling 3-4 Å resolution for membrane proteins

    • NMR spectroscopy:

      • Solution NMR for dynamic regions

      • Solid-state NMR for membrane-embedded domains

  • Computational structural biology:

    • Homology modeling based on related bacterial phosphatidate cytidylyltransferases

    • Molecular dynamics simulations to understand:

      • Membrane integration

      • Substrate binding mechanisms

      • Conformational changes during catalysis

    • Virtual screening of compound libraries against predicted binding sites

  • Structure-based inhibitor development:

    • Fragment-based drug discovery:

      • Screening small molecular fragments (MW <300)

      • NMR or X-ray crystallography to identify binding fragments

      • Fragment growing, linking, or merging strategies

    • Structure-activity relationship studies:

      • Synthesis of compound series based on initial hits

      • Assessment of binding affinity using ITC, SPR, or MST

      • Correlation of structural features with inhibitory activity

  • Validation approaches:

    • Site-directed mutagenesis of key residues identified in structural studies

    • Enzyme kinetics with purified protein to establish inhibition mechanisms

    • Cellular studies to confirm target engagement and antimicrobial activity

    • In vivo efficacy in animal models of brucellosis

This integrated structural biology approach would provide insights into cdsA function while simultaneously enabling rational design of selective inhibitors that could serve as leads for novel anti-Brucella therapeutics.

What are the latest approaches for studying cdsA protein-protein interactions and their significance in Brucella pathogenesis?

Investigating cdsA protein-protein interactions requires sophisticated methodologies to understand its functional networks in Brucella pathogenesis:

  • Affinity-based interaction mapping:

    • Tandem affinity purification (TAP):

      • Generating B. melitensis strains expressing TAP-tagged cdsA

      • Sequential purification steps to isolate protein complexes

      • Mass spectrometry identification of interaction partners

    • Co-immunoprecipitation with antibodies against:

      • Native cdsA

      • Epitope-tagged recombinant cdsA

      • Potential interaction partners

  • Proximity-based labeling techniques:

    • BioID or TurboID approach:

      • Fusion of biotin ligase to cdsA

      • Expression in B. melitensis

      • Biotinylation of proximal proteins

      • Streptavidin pulldown and proteomic analysis

    • APEX2 proximity labeling:

      • Peroxidase-based labeling of nearby proteins

      • Particularly useful for membrane protein interactions

  • In vivo interaction validation:

    • Bacterial two-hybrid systems adapted for membrane proteins:

      • BACTH (Bacterial Adenylate Cyclase Two-Hybrid)

      • Split-ubiquitin based systems

    • Fluorescence-based approaches:

      • FRET (Förster Resonance Energy Transfer)

      • BiFC (Bimolecular Fluorescence Complementation)

      • Advanced microscopy to visualize interactions in living bacteria

  • Functional network analysis:

    • Genetic interaction mapping:

      • Synthetic lethality screens

      • Suppressor mutations analysis

    • Transcriptomics integration:

      • Correlation of cdsA expression with potential partners

      • Network analysis of co-regulated genes

  • Dynamic interactions during infection:

    • Time-resolved interactomics:

      • Sampling at multiple infection timepoints

      • Comparison between intracellular and extracellular bacteria

    • Host-pathogen protein interactions:

      • Cross-linking approaches to capture transient interactions

      • Systems biology integration of host and pathogen networks

Understanding cdsA interactions would elucidate its role in phospholipid biosynthesis complexes and potentially reveal connections to virulence mechanisms, particularly those involving membrane remodeling during intracellular infection phases.

How can transcriptomic and proteomic approaches be integrated to understand the regulation of cdsA expression during different stages of infection?

Integration of transcriptomic and proteomic approaches to study cdsA regulation during infection requires sophisticated multi-omics strategies:

  • Temporal transcriptomic profiling:

    • RNA-Seq analysis of B. melitensis:

      • During macrophage infection at multiple timepoints (0.5, 4, 12, 24, 48 hours)

      • In various infection models (professional vs. non-professional phagocytes)

      • In vivo samples from animal models at different disease stages

    • Transcription start site mapping:

      • dRNA-Seq to identify primary transcripts

      • Characterization of cdsA promoter architecture

      • Identification of transcriptional regulators through motif analysis

  • Quantitative proteomics:

    • MS-based approaches:

      • Label-free quantification

      • SILAC or TMT labeling for comparative analysis

      • Targeted proteomics (PRM/MRM) for specific quantification of cdsA

    • Protein localization and turnover:

      • Pulse-chase experiments to determine protein half-life

      • Subcellular fractionation to track spatial distribution

      • Post-translational modification analysis

  • Multi-omics data integration:

    • Correlation analysis between:

      • cdsA transcript levels

      • Protein abundance

      • Enzymatic activity

    • Pathway reconstruction:

      • Integration with metabolomic data on phospholipid intermediates

      • Flux analysis of membrane biosynthesis pathways

      • Regulatory network modeling

  • Experimental validation:

    • Reporter systems:

      • Transcriptional fusions (cdsA promoter-GFP)

      • Translational fusions to track protein expression

    • Regulatory element analysis:

      • Promoter dissection through mutational analysis

      • Identification of transcription factor binding through ChIP-Seq

      • Small RNA regulation investigation

  • Infection-specific regulation:

    • Host-induced signals:

      • pH changes in the Brucella-containing vacuole

      • Nutrient limitation effects

      • Oxidative stress responses

    • Coordination with virulence systems:

      • Relationship with virB expression and type IV secretion

      • Connection to other membrane biogenesis pathways

This integrated approach would provide comprehensive understanding of how cdsA expression is modulated throughout the Brucella infection cycle, potentially revealing key regulatory nodes that could be targeted for therapeutic intervention.

What are the major technical challenges in working with recombinant cdsA, and how can they be overcome?

Researchers face several technical challenges when working with recombinant Brucella melitensis cdsA that can be addressed through specialized methodologies:

  • Membrane protein expression barriers:

    • Challenge: Low expression yields and protein aggregation

    • Solutions:

      • Fusion tag optimization (SUMO, MBP, or Mistic tags)

      • Specialized expression hosts (C41/C43 E. coli strains)

      • Reduced temperature expression (16-20°C)

      • Codon optimization for expression host

      • Cell-free expression systems with supplied detergents or nanodiscs

  • Protein solubilization and purification:

    • Challenge: Maintaining native conformation during extraction

    • Solutions:

      • Systematic detergent screening (DDM, LMNG, GDN)

      • Styrene maleic acid lipid particles (SMALPs) for native membrane extraction

      • Nanodiscs for reconstitution in membrane-like environment

      • Purification under strictly controlled redox conditions

      • Addition of specific lipids during purification

  • Enzymatic activity preservation:

    • Challenge: Loss of activity during purification

    • Solutions:

      • Inclusion of substrate analogs during purification

      • Addition of stabilizing agents (glycerol, specific lipids)

      • Rapid processing at controlled temperatures

      • Reconstitution into proteoliposomes for activity assays

  • Structural characterization:

    • Challenge: Obtaining structural information for membrane proteins

    • Solutions:

      • Lipidic cubic phase crystallization

      • Detergent-free cryo-EM approaches

      • Hydrogen-deuterium exchange mass spectrometry

      • Site-directed spin labeling with EPR spectroscopy

  • Antibody generation:

    • Challenge: Limited immunogenicity of hydrophobic regions

    • Solutions:

      • Peptide-based immunization targeting predicted exposed loops

      • Genetic immunization using DNA vaccines

      • Phage display antibody selection

      • Nanobody development from camelid immunization

The implementation of these specialized approaches can significantly improve success rates when working with this challenging membrane protein, enabling more comprehensive functional and structural characterization.

How can researchers effectively differentiate between the direct and indirect effects of cdsA modulation on Brucella virulence?

Distinguishing direct from indirect effects of cdsA modulation on Brucella virulence requires sophisticated experimental designs:

  • Genetic complementation strategies:

    • Precise genetic manipulation:

      • Clean deletion mutants with unmarked, in-frame deletions

      • Conditional expression systems (tetracycline-regulated)

      • Point mutations in catalytic residues vs. structural domains

    • Complementation controls:

      • Wild-type cdsA expression from native vs. heterologous promoters

      • Enzymatically inactive variants maintaining structural integrity

      • Heterologous cdsA from related bacteria

  • Temporal analysis of effects:

    • Time-course experiments:

      • Early vs. late events after cdsA modulation

      • Correlation with phospholipid biosynthesis kinetics

      • Progression of phenotypic changes

    • Single-cell analysis:

      • Time-lapse microscopy with fluorescent reporters

      • Flow cytometry for population heterogeneity assessment

      • Microfluidic devices for continuous monitoring

  • Biochemical verification approaches:

    • Metabolic profiling:

      • Lipidomic analysis to confirm direct impact on phospholipid synthesis

      • Metabolic flux analysis with stable isotope labeling

      • Correlation of lipid composition with virulence phenotypes

    • Target engagement studies:

      • Thermal shift assays to confirm binding of inhibitors

      • Activity-based protein profiling

      • Crosslinking approaches to capture enzyme-substrate interactions

  • Multi-level data integration:

    • Transcriptome analysis to identify compensatory responses

    • Proteome changes in response to cdsA modulation

    • Structural studies of membrane integrity and composition

    • Systems biology modeling to predict direct vs. cascade effects

  • Infection model specialization:

    • Cell-type specific effects:

      • Professional vs. non-professional phagocytes

      • Different activation states of macrophages

    • In vivo dissection:

      • Tissue-specific analysis in animal models

      • Temporal sampling during infection progression

These approaches collectively enable researchers to build a comprehensive understanding of how cdsA directly affects phospholipid biosynthesis and how these effects cascade to influence various aspects of Brucella virulence and host interaction.

What are the considerations for interpreting contradictory results in cdsA research, particularly between in vitro and in vivo studies?

Resolving contradictions between in vitro and in vivo cdsA findings requires systematic analysis of multiple factors:

  • Experimental context differences:

    • Environmental parameters:

      • Growth medium composition effects on gene expression

      • Oxygen tension differences (aerobic labs vs. microaerobic host niches)

      • pH variations between culture systems and infection models

      • Presence of host factors in vivo absent from in vitro systems

    • Methodological standardization:

      • Growth phase effects (logarithmic vs. stationary)

      • Inoculum preparation differences

      • Bacterial adaptation to laboratory conditions

  • Host factor interactions:

    • Immune response effects:

      • Pressure from adaptive immunity in vivo

      • Cytokine environments affecting bacterial gene expression

      • Nutrient restriction by host defense mechanisms

    • Tissue-specific microenvironments:

      • Liver vs. spleen vs. reproductive tract conditions

      • Cell type-specific interactions (macrophages vs. trophoblasts)

  • Technical analysis considerations:

    • Sensitivity limitations:

      • Detection thresholds in different systems

      • Temporal resolution of sampling

      • Spatial heterogeneity in in vivo infections

    • Statistical approaches:

      • Power analysis to determine adequate sample sizes

      • Appropriate statistical tests for each experimental design

      • Meta-analysis techniques for contradictory literature results

  • Genetic drift and strain variations:

    • Laboratory adaptation:

      • Comparison of recent clinical isolates vs. laboratory strains

      • Whole genome sequencing to identify compensatory mutations

      • Virulence attenuation in repeatedly passaged strains

    • Strain specificity:

      • B. melitensis biotype variations

      • Comparison across Brucella species

      • Geographic strain differences

  • Analytical framework for resolution:

    • Decision tree for evaluating contradictions:

      • Hierarchical classification of evidence quality

      • Replication requirements before accepting findings

      • Integration of multiple methodological approaches

    • Consensus development strategies:

      • Multi-laboratory validation studies

      • Standardized protocols development

      • Minimum information reporting standards

This comprehensive approach allows researchers to systematically evaluate contradictory findings, determine their biological significance, and establish a coherent understanding of cdsA function in Brucella pathogenesis across experimental systems.

What emerging technologies could advance our understanding of cdsA structure-function relationships in Brucella?

Several cutting-edge technologies show promise for elucidating cdsA structure-function relationships:

  • Advanced structural biology approaches:

    • Single-particle cryo-electron microscopy:

      • Direct visualization of membrane-embedded cdsA at near-atomic resolution

      • Capturing different conformational states during catalytic cycle

      • Visualization of protein-lipid interactions

    • Integrative structural biology:

      • Combining X-ray crystallography, NMR, SAXS, and computational modeling

      • In-cell structural determination using genetic code expansion

      • High-throughput crystallization using lipidic cubic phase robots

  • Native membrane protein analysis:

    • Native mass spectrometry:

      • Analysis of intact membrane protein complexes

      • Determination of lipid binding specificities

      • Characterization of post-translational modifications

    • Advanced microscopy:

      • Super-resolution imaging of cdsA localization in bacterial membranes

      • Single-molecule tracking to monitor dynamics

      • Correlative light and electron microscopy for contextual localization

  • Functional genomics innovations:

    • CRISPR interference/activation systems adapted for Brucella:

      • Precise temporal control of cdsA expression

      • Combinatorial perturbation with other genes

      • Genome-wide screens for genetic interactions

    • Base editing and prime editing:

      • Introduction of specific amino acid changes without selection markers

      • Systematic mutagenesis of catalytic and regulatory domains

      • Creation of conditional alleles

  • Computational advances:

    • AI-based structure prediction:

      • AlphaFold2/RoseTTAFold for accurate membrane protein modeling

      • Molecular dynamics simulations with enhanced sampling

      • Quantum mechanics/molecular mechanics for reaction mechanism studies

    • Systems biology integration:

      • Multi-scale modeling from atomic to cellular levels

      • Network analysis of cdsA within membrane biogenesis pathways

      • Prediction of emergent phenotypes from molecular perturbations

These technologies promise to reveal unprecedented details about cdsA structure, dynamics, and interactions, potentially identifying novel intervention points for antimicrobial development against this essential enzyme.

How might high-throughput screening approaches be optimized to identify novel inhibitors of B. melitensis cdsA?

Optimizing high-throughput screening for novel B. melitensis cdsA inhibitors requires specialized approaches for this membrane-associated enzyme:

  • Assay development for primary screening:

    • Biochemical assay optimization:

      • Fluorescence-based detection of pyrophosphate release

      • FRET-based substrate conversion monitoring

      • Label-free technologies (thermal shift, SPR, BLI)

      • Considerations for membrane protein screening:

        • Detergent selection for stability vs. activity

        • Reconstitution in nanodiscs or proteoliposomes

        • Miniaturization to 384 or 1536-well formats

    • Cell-based screening systems:

      • Engineered E. coli with B. melitensis cdsA under conditional promoters

      • Growth inhibition coupled to cdsA expression

      • Reporter gene systems linked to phospholipid biosynthesis

      • Brucella spheroplasts for direct screening

  • Compound library selection and design:

    • Focused libraries targeting:

      • Nucleotide-binding enzymes

      • Phospholipid biosynthesis pathways

      • Bacterial membrane proteins

    • Diversity-oriented collections:

      • Natural product extracts, particularly from soil microorganisms

      • Fragment-based libraries for binding site identification

      • Peptidomimetics targeting protein-protein interfaces

  • Advanced screening methodologies:

    • Biophysical screening cascades:

      • Initial high-throughput virtual screening

      • Secondary validation with thermal shift assays

      • Detailed characterization with ITC, SPR, or MST

    • Phenotypic screening integration:

      • Parallel screening against intact Brucella

      • Target engagement confirmation in living bacteria

      • Multi-parameter phenotypic profiling

  • Data analysis and hit prioritization:

    • Machine learning approaches for:

      • Hit prediction from primary screening data

      • Activity pattern recognition

      • Structure-activity relationship development

    • Cheminformatic filters for:

      • Physicochemical properties suitable for bacterial penetration

      • Selectivity against human homologs

      • Structural novelty assessment

  • Hit-to-lead progression strategies:

    • Medicinal chemistry workflows:

      • Structure-guided optimization

      • Iterative synthesis and testing cycles

      • ADME property improvement

    • Validation cascades:

      • Confirmation in multiple Brucella strains

      • Intracellular activity assessment

      • Off-target screening

This comprehensive approach addresses the unique challenges of targeting a membrane-associated enzyme like cdsA, increasing the likelihood of identifying viable lead compounds for further development.

What potential translational applications may emerge from detailed characterization of B. melitensis cdsA beyond vaccine and therapeutic development?

Beyond vaccines and therapeutics, detailed characterization of B. melitensis cdsA offers diverse translational applications:

  • Diagnostic innovations:

    • Point-of-care detection systems:

      • Antibody-based lateral flow assays targeting cdsA

      • Aptamer-based biosensors for Brucella detection

      • CRISPR-Cas12/13-based molecular diagnostics

    • Advanced serological approaches:

      • Multiplex arrays including cdsA with other Brucella antigens

      • Machine learning algorithms for improved sensitivity/specificity

      • Differentiation between vaccinated and infected animals

  • Bioengineering applications:

    • Enzyme repurposing for biotechnology:

      • Engineered cdsA variants for novel phospholipid synthesis

      • Industrial production of specialized phospholipids

      • Creation of modified membranes with desired properties

    • Synthetic biology platforms:

      • Minimal membrane biosynthesis systems

      • Artificial cells with defined membrane composition

      • Membrane protein production optimization

  • Agricultural applications:

    • Environmental detection systems:

      • Monitoring water and soil for Brucella contamination

      • Surveillance in livestock production facilities

      • Testing of milk and dairy products

    • Improved livestock management:

      • Risk assessment tools based on molecular epidemiology

      • Targeted testing protocols for high-risk animals

      • Economical surveillance strategies for developing regions

  • Basic science insights:

    • Evolutionary biology:

      • Understanding phospholipid biosynthesis evolution

      • Host-pathogen co-evolution models

      • Bacterial adaptation to specialized intracellular niches

    • Cell biology applications:

      • Models for membrane biogenesis regulation

      • Intracellular trafficking studies

      • Host-pathogen interaction paradigms

  • One Health approaches:

    • Integrated surveillance systems:

      • Molecular markers for transmission pathway identification

      • Cross-species monitoring platforms

      • Environmental sampling strategies

    • Computational epidemiology:

      • Predictive models for brucellosis outbreaks

      • Risk factor analysis using molecular data

      • Resource allocation optimization for control programs

These diverse applications demonstrate how fundamental research on cdsA can generate value across multiple domains beyond the immediate goals of therapeutic development, contributing to broader public health, agricultural, and scientific advancement.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.