Recombinant Brucella melitensis biotype 1 Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Brucella melitensis biotype 1 Prolipoprotein Diacylglyceryl Transferase (Lgt)

Recombinant Brucella melitensis biotype 1 Prolipoprotein Diacylglyceryl Transferase (Lgt) is a recombinant protein derived from the bacterium Brucella melitensis, a pathogen responsible for brucellosis in humans and animals. This enzyme plays a crucial role in the modification of lipoproteins, which are essential for bacterial cell membrane integrity and function. Lgt catalyzes the transfer of a diacylglyceryl group from phosphatidylglycerol to the conserved cysteine residue of preprolipoproteins, forming a thioether bond. This modification is critical for the maturation and localization of lipoproteins in the bacterial cell membrane.

Function and Importance of Lgt

Lgt is an inner membrane protein that is vital for bacterial growth and survival. It is involved in the first step of lipoprotein modification, which is essential for the proper functioning of lipoproteins in bacterial physiology and pathogenesis. The enzyme's activity ensures that lipoproteins are correctly anchored to the bacterial membrane, facilitating various cellular processes such as nutrient uptake and cell signaling.

FunctionDescription
Lipoprotein ModificationTransfers diacylglyceryl group from phosphatidylglycerol to preprolipoproteins.
Membrane AnchoringEnsures lipoproteins are correctly anchored to the bacterial membrane.
Bacterial GrowthEssential for bacterial viability and growth.

Studies on Lgt from Escherichia coli have identified several essential residues critical for its function. These include Y26, N146, G154, and R239, which are located within the transmembrane segments or loops. The Lgt signature motif, which includes invariant residues, is also crucial for enzyme activity and is conserved across different bacterial species.

Essential ResidueLocationFunction
Y26TM-1Essential for activity.
N146TM-4Essential for activity.
G154Loop between TM-4 and head domainEssential for activity.
R239TM-6Essential for activity.

Research Findings and Applications

Recombinant Lgt proteins, such as those from Brucella melitensis, are used in research to study lipoprotein modification pathways and their role in bacterial pathogenesis. These proteins are also valuable tools for developing diagnostic assays and vaccines against brucellosis.

ApplicationDescription
Diagnostic AssaysUsed in ELISA kits for detecting antibodies against Brucella melitensis.
Vaccine DevelopmentPotential antigen for vaccine development against brucellosis.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lgt; BMEI0488; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-281
Protein Length
full length protein
Species
Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)
Target Names
lgt
Target Protein Sequence
MIETLLPASALAFPAIDPVIFRVGPLAVHWYGLGYVVGILFAWWYGKKLLRSHRLWANNQ PPMAPEALDDFVIWAALGVVLGGRIGYVLFYNFSYYISNPLAIPALWDGGMSFHGGILGT TLAMILFARSRGILVWSMFDTIAAGVPIGLGVVRVANFINSELWGRVSDVPWAVYFPNGG PLPRHPSQLYEAFLEGLVLFFVLFVLVWGARKLKQPGFVAGAFVTGYGLSRIAVEFFREP DAQIGYLFGGWLTMGMVLSVPMVLLGLWAMWRANRAAARNA
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the N-terminal cysteine sulfhydryl group of a prolipoprotein. This is the initial step in the maturation of lipoproteins.

Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Prolipoprotein diacylglyceryl transferase (lgt) and what role does it play in Brucella melitensis?

Prolipoprotein diacylglyceryl transferase (lgt) is an enzyme (EC 2.4.99.-) encoded by the lgt gene (locus BMEI0488) in Brucella melitensis. This protein plays a critical role in the post-translational modification of bacterial lipoproteins by catalyzing the transfer of a diacylglyceryl moiety from phosphatidylglycerol to the sulfhydryl group of the cysteine residue in the lipobox of prolipoproteins . This modification is essential for proper anchoring of lipoproteins to the bacterial membrane, which influences the bacterium's virulence, survival, and interaction with host cells. The enzyme's importance lies in its involvement in bacterial membrane integrity and potential role in pathogenesis, making it a valuable target for research into Brucella infection mechanisms .

How does the expression pattern of lgt vary across different growth phases of B. melitensis?

The expression of lgt in B. melitensis demonstrates significant growth phase-dependent variation. Microarray analysis has revealed that cultures in late logarithmic growth phase show different gene expression patterns compared to those in stationary phase. While lgt-specific expression data was not explicitly detailed in the available research, studies have shown that genes associated with membrane transport and biogenesis of the cell envelope—functional categories that would include lgt—are predominantly up-regulated during the late logarithmic growth phase .

This up-regulation correlates with enhanced invasiveness of B. melitensis to epithelial cells during the late logarithmic phase compared to stationary phase cultures. The differential expression pattern suggests that lgt may be regulated as part of the bacterium's adaptive response to growth conditions and preparation for host cell invasion . This growth phase-dependent regulation provides valuable insights for researchers designing experiments that aim to study the protein's function in realistic physiological contexts.

What are the optimal conditions for expressing recombinant B. melitensis lgt in E. coli expression systems?

For optimal expression of recombinant B. melitensis lgt in E. coli systems, researchers typically employ the following methodology:

  • Vector Selection: Cold-shock expression vectors like pCold I have proven effective for expression of Brucella proteins . These vectors contain elements that enhance expression at lower temperatures, which can improve folding of membrane proteins.

  • Host Strain Selection: E. coli strains such as DH5α or BL21(DE3) are commonly used for recombinant protein expression . The choice depends on the specific requirements of the experiment.

  • Growth Conditions:

    • Medium: LB (Luria-Bertani) with appropriate antibiotic selection (typically 50 μg/ml ampicillin)

    • Temperature: Initial growth at 37°C until reaching OD600 of 0.5-0.6

    • Induction: Temperature reduction to 15-18°C, followed by addition of IPTG (0.1-1.0 mM)

    • Post-induction incubation: 16-24 hours at reduced temperature

  • Purification Strategy:

    • Extraction: Typically using mild detergents to solubilize membrane-associated proteins

    • Affinity chromatography: His-tag purification using Ni-NTA columns

    • Verification: SDS-PAGE and Western blot analysis using anti-His antibodies

This methodology has been successfully applied to similar Brucella proteins and can be adapted specifically for lgt expression with appropriate optimization of induction conditions and purification parameters.

What methods can be used to evaluate the enzymatic activity of recombinant lgt in vitro?

The enzymatic activity of recombinant lgt can be evaluated through several complementary approaches:

  • Radiolabeled Substrate Assay:

    • Incubate the purified recombinant lgt with [³H]-labeled phosphatidylglycerol and synthetic prolipoprotein substrates

    • Extract lipid-modified peptides and measure radioactivity incorporation using scintillation counting

    • This method provides quantitative measurement of diacylglyceryl transfer activity

  • FRET-Based Assay:

    • Design synthetic prolipoprotein peptides containing FRET pairs that change signal upon diacylglycerol modification

    • Monitor real-time enzymatic activity through fluorescence changes

    • This approach allows for kinetic analysis of enzyme activity

  • Mass Spectrometry Analysis:

    • Incubate recombinant lgt with synthetic prolipoproteins and phospholipid substrates

    • Analyze reaction products by mass spectrometry to detect mass shifts corresponding to diacylglyceryl addition

    • This provides detailed structural information about the modified products

  • Comparative Protein Expression Analysis:

    • Express lgt in bacterial systems with and without induction

    • Analyze total cell lysates by SDS-PAGE to confirm protein expression

    • Use Western blot with specific antibodies (e.g., anti-His tag) to verify the presence and quantity of recombinant lgt

The combination of these methods provides comprehensive characterization of lgt enzymatic function, substrate specificity, and reaction kinetics.

How can researchers differentiate between functional and non-functional forms of recombinant lgt?

Differentiating functional from non-functional forms of recombinant lgt requires a multi-faceted approach:

  • Structural Integrity Assessment:

    • Circular dichroism (CD) spectroscopy to evaluate secondary structure elements

    • Tryptophan fluorescence to assess tertiary structure integrity

    • Size-exclusion chromatography to detect aggregation or oligomerization states

  • Functional Assays:

    • Enzyme activity assays using synthetic substrates (as described above)

    • Complementation studies in lgt-deficient bacterial strains to determine if the recombinant protein restores normal phenotype

    • Membrane incorporation assays to verify proper localization

  • Binding Studies:

    • Surface plasmon resonance (SPR) to measure binding kinetics with substrate analogs

    • Isothermal titration calorimetry (ITC) to determine thermodynamic parameters of substrate binding

  • Stability Analysis:

    • Thermal shift assays to determine protein stability

    • Limited proteolysis to assess conformational flexibility and integrity

    • Storage stability studies at different temperatures and buffer conditions

For confirmation, researchers should perform Western blot analysis with specific antibodies targeting conformational epitopes or activity-dependent modifications . A fully functional lgt should demonstrate both proper structural characteristics and enzymatic activity within parameters similar to those observed for the native protein in Brucella melitensis.

How does lgt contribute to the pathogenesis and virulence mechanisms of Brucella melitensis infections?

The contribution of lgt to Brucella melitensis pathogenesis involves several critical mechanisms:

  • Cell Invasion Facilitation: Gene expression studies demonstrate that Brucella at late logarithmic growth phase, when lgt and related genes are up-regulated, show significantly increased invasiveness in epithelial cells compared to stationary phase cultures . This suggests lgt's involvement in preparing the bacterium for host cell entry.

  • Membrane Integrity and Stress Response: As a protein involved in lipoprotein processing, lgt helps maintain outer membrane integrity, which is crucial for surviving host immune responses. Properly processed lipoproteins contribute to the bacterium's ability to withstand environmental stresses within host cells.

  • Immune Recognition and Evasion: Lipoproteins processed by lgt serve as pathogen-associated molecular patterns (PAMPs) that interact with host pattern recognition receptors. Properly functioning lgt ensures correct lipoprotein presentation, potentially influencing immune evasion strategies.

  • Intracellular Survival Mechanisms: The lipoproteins processed by lgt likely contribute to Brucella's remarkable ability to survive within macrophages and establish chronic infection. This may occur through modulation of phagosome maturation or by facilitating nutrient acquisition within the intracellular niche.

  • Growth Phase-Dependent Virulence Regulation: Transcriptome analysis has revealed that lgt expression fluctuates with growth phase, with higher expression during late logarithmic phase correlating with enhanced invasion capacity . This suggests that lgt is part of a coordinated virulence program activated during specific growth stages.

Understanding these pathogenic mechanisms has implications for vaccine development strategies, as evidenced by research exploring recombinant DNA vaccines targeting Brucella epitopes .

What structural and functional differences exist between lgt from B. melitensis and its homologs in other bacterial pathogens?

A comparative analysis of lgt from B. melitensis and its homologs reveals several significant structural and functional distinctions:

FeatureB. melitensis lgtOther Bacterial Pathogens lgtFunctional Significance
Sequence conservationReference sequence (281 aa) 40-60% identity with Gram-negative pathogensReflects evolutionary adaptation to specific bacterial membrane composition
Transmembrane domainsMultiple hydrophobic regionsVarying numbers and arrangementsMay impact substrate specificity and membrane localization
Catalytic siteConserved histidine and cysteine residuesSimilar catalytic residues with species-specific variationsCore enzymatic function preserved while allowing species-specific activity
Substrate specificityPreference for Brucella-specific lipobox motifsPathogen-specific preferencesEvolved to recognize species-specific lipoprotein sequences
Regulatory elementsGrowth phase-dependent regulation Various regulatory mechanismsReflects integration into different virulence programs
Inhibitor sensitivityUndefined in available researchVaries by bacterial speciesPotential for species-selective therapeutic targeting

These differences highlight the species-specific adaptation of lgt while maintaining its core enzymatic function. Understanding these distinctions is crucial for developing targeted antimicrobial strategies that exploit the unique characteristics of B. melitensis lgt without affecting commensal bacteria.

How can recombinant lgt be utilized in the development of novel diagnostic tools for brucellosis?

Recombinant lgt from B. melitensis offers several innovative approaches for developing improved brucellosis diagnostics:

  • ELISA-Based Detection Systems:

    • Recombinant lgt can serve as a highly specific antigen in enzyme-linked immunosorbent assays

    • The protein can be immobilized on plates to capture Brucella-specific antibodies from patient sera

    • This approach may enable differentiation between vaccinated and naturally infected animals/humans

  • Lateral Flow Immunochromatographic Tests:

    • Recombinant lgt can be incorporated into rapid point-of-care diagnostic devices

    • When conjugated with gold nanoparticles or other detectable markers, it enables field-deployable testing

    • This addresses the need for diagnostics in resource-limited settings where brucellosis is endemic

  • Multiplex Serological Arrays:

    • Integration of lgt with other Brucella immunodominant proteins creates comprehensive diagnostic panels

    • This increases diagnostic sensitivity while maintaining specificity

    • Particularly valuable for detecting varied antibody responses across different disease stages

  • Molecular Beacon Probes for PCR:

    • Design of lgt-specific molecular beacons for real-time PCR detection of Brucella

    • Enables quantitative assessment of bacterial load in clinical samples

    • Provides species and biovar-level identification when combined with other genetic markers

  • Differential Diagnostic Applications:

    • Current vaccines using live-attenuated Brucella strains interfere with diagnostics as they cannot be distinguished from natural infections

    • Recombinant lgt-based tests could potentially differentiate between vaccine-induced and infection-induced immune responses

    • This addresses a major limitation in current brucellosis control programs

The development of these diagnostic approaches would significantly enhance brucellosis surveillance and control efforts, particularly in regions where the disease remains endemic .

What are the main challenges in purifying functional recombinant lgt and how can they be overcome?

Purifying functional recombinant lgt presents several significant challenges due to its membrane-associated nature. The following table outlines these challenges and corresponding solutions:

ChallengeCauseSolution StrategiesExpected Outcomes
Low expression levelsMembrane protein toxicity to host cellsUse tightly regulated expression systems; Cold-shock induction systems (pCold vectors) Increased yield without compromising host cell viability
Protein insolubilityHydrophobic transmembrane domainsFusion with solubility-enhancing tags (MBP, SUMO); Optimization of detergent extraction protocolsImproved solubility while maintaining native conformation
MisfoldingImproper membrane integration in heterologous systemsExpression at lower temperatures (15-18°C); Addition of molecular chaperonesEnhanced proportion of correctly folded protein
Loss of activity during purificationDetergent-induced structural disruptionScreen multiple detergent types and concentrations; Use amphipols or nanodiscs for stabilizationPreservation of enzymatic activity through purification process
Aggregation during storageHydrophobic interactions between protein moleculesAddition of glycerol (50%) ; Optimize buffer composition; Store at -20°C or -80°CExtended shelf-life and maintained functionality
Contaminating lipidsCo-purification of host cell lipidsAdditional ion exchange chromatography steps; Hydroxyapatite chromatographyHigher purity preparation suitable for structural studies
Variable activity in functional assaysConformational heterogeneitySize exclusion chromatography to isolate homogeneous fractions; Activity-based protein profilingMore reliable and reproducible activity measurements

By implementing these methodological strategies, researchers can significantly improve the yield and quality of purified recombinant lgt for subsequent structural and functional studies. Verification of successful purification should be performed using SDS-PAGE and Western blot analysis with appropriate antibodies, such as anti-His tag antibodies for tagged recombinant proteins .

How should researchers design experiments to study the interaction between lgt and host cell components during Brucella infection?

Designing experiments to study lgt-host interactions requires carefully constructed methodologies that capture the complexity of the infection process. The following approach is recommended:

  • Protein-Protein Interaction Studies:

    • Yeast Two-Hybrid Screening: Identify potential host cell binding partners of lgt

    • Pull-Down Assays: Utilize tagged recombinant lgt to isolate interacting host proteins

    • Biolayer Interferometry: Measure binding kinetics between purified lgt and candidate host proteins

    • Proximity Labeling: Use BioID or APEX2 fusions with lgt to identify proximal proteins in living cells

  • Cellular Localization Experiments:

    • Immunofluorescence Microscopy: Track lgt localization during different stages of infection using specific antibodies

    • Subcellular Fractionation: Determine which host cell compartments contain lgt after infection

    • Live Cell Imaging: Monitor real-time trafficking of fluorescently-tagged lgt during infection

  • Functional Impact Assessment:

    • RNA Interference: Silence host genes encoding potential lgt interaction partners

    • CRISPR/Cas9 Knockout: Generate host cell lines lacking specific interaction partners

    • Dominant Negative Constructs: Express mutated versions of host proteins to disrupt interactions

    • Invasion Assays: Compare invasion efficiency of wild-type vs. lgt-deficient Brucella strains

  • Temporal Dynamics Analysis:

    • Time-Course Experiments: Sample infected cells at multiple time points post-infection

    • Pulse-Chase Studies: Track the fate of lgt molecules over time during infection

    • Conditional Expression Systems: Control lgt expression at different stages of infection

  • Validation in Primary Cells and Animal Models:

    • Ex Vivo Infections: Test interactions in primary cells from natural host species

    • Transgenic Animal Models: Create models expressing tagged versions of lgt interaction partners

    • Comparative Studies: Analyze differences in interaction patterns across susceptible and resistant host species

This comprehensive experimental design framework enables systematic investigation of lgt's role in host-pathogen interactions during Brucella infection, potentially revealing new targets for therapeutic intervention.

What considerations are important when using recombinant lgt in immunological studies and vaccine development?

When utilizing recombinant lgt in immunological studies and vaccine development, researchers should address several critical considerations:

  • Protein Purity and Endotoxin Contamination:

    • Ensure thorough removal of host cell-derived endotoxins that could confound immunological readouts

    • Implement endotoxin testing (LAL assay) with acceptable limits <0.1 EU/μg protein

    • Consider additional purification steps such as polymyxin B columns for endotoxin removal

  • Conformational Authenticity:

    • Verify that recombinant lgt maintains native-like conformation through circular dichroism or epitope mapping

    • Assess whether critical immunogenic epitopes are properly presented

    • Compare immunoreactivity with sera from naturally infected hosts to confirm antigenic similarity

  • Adjuvant Selection and Formulation:

    • Test multiple adjuvant systems to identify optimal immune response profiles

    • Consider delivery vehicles that mimic the membrane context of native lgt

    • Evaluate stability of lgt in various formulations under different storage conditions

  • Differentiation of Infected from Vaccinated Animals (DIVA):

    • Design recombinant constructs that allow serological differentiation between vaccinated and infected animals

    • Current live-attenuated Brucella vaccines interfere with diagnostics as they cannot be distinguished from natural infections

    • Recombinant DNA vaccines offer potential solutions to this diagnostic challenge

  • Safety Assessment:

    • Evaluate potential cross-reactivity with host proteins to prevent autoimmune responses

    • Assess the stability of the recombinant construct to prevent reversion to virulence

    • Confirm safety in pregnant animals, as current live vaccines can cause abortion

  • Immunological Response Characterization:

    • Analyze both humoral and cell-mediated immune responses

    • Evaluate long-term protection and memory response durability

    • Assess cross-protection against different Brucella species, as the main species share 99% identity at the DNA level

These considerations are particularly relevant for developing next-generation Brucella vaccines, where recombinant DNA approaches offer advantages over traditional live-attenuated vaccines in terms of safety and diagnostic compatibility .

How might advanced structural biology techniques advance our understanding of lgt function in Brucella pathogenesis?

Advanced structural biology techniques offer unprecedented opportunities to elucidate lgt's role in Brucella pathogenesis:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Enabling visualization of lgt in its native membrane environment without crystallization

    • Revealing dynamic conformational changes during substrate binding and catalysis

    • Providing structural insights at near-atomic resolution to guide rational drug design

  • X-ray Crystallography of Protein-Substrate Complexes:

    • Determining precise binding modes of natural substrates and inhibitors

    • Identifying critical interactions that could be targeted for therapeutic intervention

    • Comparing structural differences between lgt from Brucella and other bacterial species

  • Nuclear Magnetic Resonance (NMR) Spectroscopy:

    • Characterizing the dynamics of protein-substrate interactions in solution

    • Mapping conformational changes induced by membrane composition variations

    • Investigating the effects of pH and temperature on enzyme activity

  • Molecular Dynamics Simulations:

    • Modeling lgt behavior within bacterial membranes of varying compositions

    • Predicting conformational changes during the catalytic cycle

    • Simulating interactions with potential inhibitors to guide drug development

  • Single-Molecule Biophysics:

    • Tracking individual enzyme molecules during catalysis using fluorescence techniques

    • Measuring force generation during membrane protein insertion

    • Revealing heterogeneity in enzyme behavior that may be masked in bulk studies

  • In-Cell Structural Biology:

    • Determining lgt structure and interactions within living Brucella cells

    • Visualizing structural changes during different stages of infection

    • Correlating structural features with gene expression data from different growth phases

These advanced approaches will bridge the current knowledge gap between lgt's sequence, structure, and function, potentially revealing novel aspects of Brucella pathogenesis and identifying new targets for therapeutic intervention.

What potential exists for using lgt as a target for novel antimicrobial development against Brucella infections?

The potential for lgt as an antimicrobial target is substantial and multifaceted:

  • Essential Function Targeting:

    • Lgt catalyzes a critical step in lipoprotein processing essential for bacterial membrane integrity

    • Inhibition would potentially disrupt multiple virulence mechanisms simultaneously

    • The growth phase-dependent expression patterns suggest targeting could disrupt the infection cycle at critical points

  • Structural Uniqueness Advantages:

    • Bacterial lgt enzymes lack eukaryotic homologs, minimizing off-target effects

    • Specific structural features of Brucella lgt could allow for selective targeting

    • The membrane-embedded nature provides opportunities for developing amphipathic inhibitors

  • Rational Drug Design Approaches:

    • Structure-based virtual screening against the catalytic site

    • Fragment-based lead discovery targeting allosteric sites

    • Peptidomimetic approaches based on natural substrate recognition patterns

  • Combination Therapy Potential:

    • Lgt inhibitors could sensitize Brucella to conventional antibiotics

    • Synergistic effects with host defense peptides that target bacterial membranes

    • Potential for reducing the required dosage of current treatments, minimizing toxicity

  • Biomarker Applications:

    • Activity-based probes targeting lgt could serve as diagnostic tools

    • Monitoring lgt inhibition could provide a measure of treatment efficacy

    • Changes in lgt expression during infection could indicate disease progression

  • Delivery System Innovations:

    • Liposomal formulations to deliver inhibitors to intracellular bacteria

    • Antibody-drug conjugates targeting Brucella-containing compartments

    • Nanoparticle-based delivery systems for improved pharmacokinetics

The development of lgt inhibitors represents a promising approach to address the limitations of current brucellosis treatments, potentially offering higher specificity, reduced treatment duration, and decreased risk of relapse compared to conventional antibiotics.

How could comparative genomics and proteomics approaches enhance our understanding of lgt variation across Brucella species and strains?

Comparative genomics and proteomics offer powerful frameworks for understanding lgt variation across the Brucella genus:

These complementary approaches would significantly enhance our understanding of how lgt variation contributes to the diverse host preferences and virulence characteristics observed across the Brucella genus, potentially revealing species-specific adaptations that could be targeted for diagnostics or therapeutics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.