Recombinant Brucella melitensis biotype 1 Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Overview and Biological Context

The htpX gene encodes a protein classified as a protease homolog, though its exact enzymatic function remains uncharacterized. It is part of the Brucella genus, which includes zoonotic pathogens causing brucellosis. While htpX is not directly linked to virulence in current literature, its conservation across Brucella species suggests potential roles in bacterial physiology or immune evasion.

Production and Characteristics

The recombinant htpX protein is produced via heterologous expression in E. coli, enabling scalable synthesis for research and diagnostic purposes. Key specifications include:

ParameterValueSource
Gene IDBMEI0236 (Brucella melitensis)
UniProt IDQ8YJ50
LengthFull-length (1–325 amino acids)
TagN-terminal His tag
Expression SystemE. coli
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer with 6% trehalose (pH 8.0)
Reconstitution InstructionsDeionized sterile water (0.1–1.0 mg/mL); 50% glycerol for long-term storage

Amino Acid Sequence (Partial):
MNMTKTAmLIALMTVMFMSIGYLLGGGGGMMIALVIAVAMNLFGYWNSDKMVLRMYNAQE...

Gene Information

The htpX gene is annotated as a protease homolog, though its biochemical activity remains unconfirmed. Key genetic details include:

AttributeDetailSource
SynonymsProtease HtpX homolog, BruAb1_1793 (Brucella abortus homolog)
Genomic LocationChromosome I (Brucella melitensis)
Functional PredictionProtein processing or degradation

Diagnostic Use

Recombinant htpX is utilized in enzyme-linked immunosorbent assays (ELISA) to detect anti-Brucella antibodies in serum. This application leverages its immunogenicity as a potential diagnostic marker.

ApplicationDetailsSource
ELISA KitsDetects IgG/IgM antibodies against B. melitensis
Cross-ReactivitySpecific to Brucella melitensis biotype 1

Experimental Studies

While htpX has not been directly studied in pathogenesis, its recombinant form serves as a tool for:

  • Antigenic profiling: Identifying immune targets in Brucella infections.

  • Vaccine development: Exploring multi-epitope vaccines, though htpX is not yet a prioritized candidate .

Future Research Directions

  1. Functional Characterization: Determine enzymatic activity and role in bacterial physiology.

  2. Immunological Studies: Investigate htpX-specific T-cell or B-cell responses in infected hosts.

  3. Diagnostic Optimization: Validate htpX as a differential diagnostic marker versus other Brucella species.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
htpX; BMEI0236; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-325
Protein Length
full length protein
Species
Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)
Target Names
htpX
Target Protein Sequence
MNMTKTAMLIALMTVMFMSIGYLLGGGGGMMIALVIAVAMNLFGYWNSDKMVLRMYNAQE VDERSAPEYYRMVSGLAANAGLPMPKVYIIHEDQPNAFATGRNPENAAVAATTGLLNWLS PEEVAGVMAHELAHVQNRDTLTMTIVATLAGAISMLGNFAFFLGGNRENGNGVMGVVGTL LAMIVAPFGAMIVQMAVSRTREYAADKRGAEICGNPLWLSSALGKIARGAKVIPNEEAEH NPATAHMFIINPLSGRGADNLFSTHPDTDNRIAALEQMAAETGIRSAAMTARAAAPSQNS GPWGQRSDNAGGNSNGGSRYRGPWS
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Brucella melitensis Protease HtpX homolog (htpX)?

Brucella melitensis Protease HtpX homolog (htpX) is a 325 amino acid protein that functions as an intracellular protease. It belongs to the HtpX family of proteases found across bacterial species and plays a role in cellular stress responses. In Brucella species, htpX is encoded by the htpX gene and has been studied for its potential involvement in pathogenesis mechanisms. The protein contains membrane-spanning regions and is thought to participate in protein quality control systems within the bacterial cell .

Unlike some other stress-response proteins such as HtrA (High-temperature requirement A), which has been extensively characterized in Brucella virulence, the specific role of htpX in Brucella's stress response and virulence mechanisms remains an area of active investigation. The protein shares structural and functional similarities with htpX homologs from other bacterial species, suggesting conservation of fundamental cellular processes .

How is recombinant Brucella htpX typically expressed and purified?

Recombinant Brucella htpX is typically expressed using the following methodology:

  • Expression System: The gene is cloned into an appropriate expression vector (typically with an N-terminal His-tag) and expressed in E. coli as the host organism .

  • Protein Extraction and Purification:

    • Bacterial cells are harvested and lysed

    • The His-tagged protein is purified using affinity chromatography

    • The purified protein is typically subjected to SDS-PAGE analysis to confirm purity (>90% purity is standard)

  • Storage and Handling:

    • The purified protein is often lyophilized for long-term storage

    • Reconstitution is recommended in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Addition of 5-50% glycerol (final concentration) is recommended before aliquoting for storage at -20°C/-80°C

    • Repeated freeze-thaw cycles should be avoided

    • Working aliquots can be stored at 4°C for up to one week

Storage ConditionsRecommendations
Long-term storage-20°C/-80°C with 5-50% glycerol
Working aliquots4°C for up to one week
Storage bufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionDeionized sterile water (0.1-1.0 mg/mL)

What is the role of htpX in Brucella stress response compared to other stress proteins?

Brucella htpX functions as part of the bacterial stress response system, but with distinct mechanisms compared to other stress proteins. Research indicates that htpX operates primarily as an intracellular protease involved in protein quality control mechanisms . Unlike some other stress response proteins, htpX appears to be specifically up-regulated in response to the accumulation of misfolded proteins, suggesting a role in proteostasis during cellular stress .

Comparative analysis with other stress response systems reveals significant differences:

  • HtpX vs. HtrA: While HtrA deletion in Brucella melitensis leads to increased susceptibility to oxidative killing and attenuation in mouse and goat models , the specific phenotype of htpX mutations has not been as extensively characterized. HtrA appears to play a more direct role in virulence, as evidenced by the inability of HtrA mutants to cause abortion in pregnant goats .

  • Stress-specificity: Unlike some general stress response proteins, htpX appears to have specificity for proteolytic processing of misfolded membrane proteins. Studies in related bacterial systems suggest htpX is not typically up-regulated in response to metal exposure, indicating a more specialized role in the stress response pathway .

  • Regulatory networks: Research in E. coli and other model organisms suggests that htpX operates in coordination with other quality control proteases, potentially with complementary or redundant functions in different stress conditions, though the specific regulatory networks in Brucella require further characterization .

The distinct role of htpX in Brucella stress response makes it an important subject for research aimed at understanding bacterial adaptation mechanisms during infection and environmental stress.

What experimental approaches are recommended for studying htpX function in Brucella?

Several complementary experimental approaches are recommended for investigating htpX function in Brucella:

  • Genetic Manipulation Techniques:

    • Transposon mutagenesis: Can be used to create htpX mutants as demonstrated in previous studies with Brucella

    • Construction of clean deletion mutants: For studying the effects of complete htpX absence

    • Complementation studies: To confirm phenotypes are specifically due to htpX disruption

    • Conditional expression systems: To study the effects of htpX under different conditions

  • Transcriptional Profiling:

    • RNA-Seq or microarray analysis: To examine global transcriptional changes in htpX mutants compared to wild-type strains

    • qRT-PCR: To quantify htpX expression under different stress conditions (oxidative stress, heat shock, pH stress)

    • Dynamic Bayesian modeling: For analyzing temporal transcriptional profiles during infection

  • Cell Culture Infection Models:

    • Professional phagocytes (macrophages): To assess intracellular survival and replication

    • Non-professional phagocytes (epithelial cells, HeLa cells): To study invasion and persistence mechanisms

    • Fluorescence microscopy: To track intracellular localization and trafficking

  • Animal Infection Models:

    • Mouse models: For systematic virulence assessment

    • Ruminant models (goats): For host-specific pathogenesis studies similar to those conducted with HtrA mutants

  • Proteomic Approaches:

    • Identification of htpX substrates using techniques like SILAC (Stable Isotope Labeling with Amino acids in Cell culture)

    • Protein-protein interaction studies: To identify binding partners

    • Activity-based protein profiling: To assess protease activity under different conditions

  • Structural Biology:

    • X-ray crystallography or cryo-EM: To determine detailed protein structure

    • Molecular dynamics simulations: To understand conformational changes during substrate binding

    • Site-directed mutagenesis: To identify critical residues for catalytic activity

How does htpX potentially contribute to Brucella virulence and pathogenesis?

The contribution of htpX to Brucella virulence and pathogenesis appears to involve several potential mechanisms, though its specific role is not as thoroughly characterized as other virulence factors like HtrA :

Understanding htpX's role in virulence could provide new targets for therapeutic intervention or vaccine development, particularly as proteases represent attractive targets due to their enzymatic activity and potential accessibility.

What methodological challenges exist in studying htpX function and how can they be addressed?

Researchers face several methodological challenges when investigating htpX function in Brucella species:

  • Functional Redundancy Among Proteases:

    • Challenge: Multiple proteases may have overlapping functions, masking phenotypes in single-gene knockout studies

    • Solution: Create multiple protease knockout combinations to reveal redundant functions

    • Approach: Implement inducible expression systems to control the expression of multiple proteases simultaneously

  • Membrane Protein Purification Difficulties:

    • Challenge: As a membrane-associated protease, htpX is difficult to purify in its native, active conformation

    • Solution: Optimize detergent conditions for solubilization while maintaining protein activity

    • Approach: Consider using nanodiscs or amphipols to stabilize the purified protein in a near-native membrane environment

  • Identifying Protease Substrates:

    • Challenge: The natural substrates of htpX in Brucella remain largely unidentified

    • Solution: Implement proteomic approaches to identify accumulated proteins in htpX mutants

    • Approach: Use techniques such as SILAC (Stable Isotope Labeling with Amino acids in Cell culture) or TMT (Tandem Mass Tag) labeling combined with mass spectrometry

  • In vivo Relevance Assessment:

    • Challenge: Translating in vitro findings to in vivo infection contexts

    • Solution: Develop appropriate animal models that recapitulate key aspects of natural infection

    • Approach: Consider natural host models (goats/cattle) for most relevant results, similar to studies conducted with HtrA mutants

  • Temporal Dynamics of Expression:

    • Challenge: htpX expression and activity may vary throughout infection stages

    • Solution: Implement time-course studies with careful synchronization of infection

    • Approach: Use reporter systems (e.g., fluorescent proteins fused to the htpX promoter) to monitor expression dynamics in real-time during infection

  • Structural Analysis Limitations:

    • Challenge: Limited structural information specific to Brucella htpX

    • Solution: Utilize comparative modeling based on related proteins while pursuing experimental structural determination

    • Approach: Combine computational predictions with targeted experimental validation of key structural features

How do htpX homologs compare across different Brucella species and biovars?

Comparative analysis of htpX homologs across Brucella species and biovars reveals important insights into evolutionary conservation and potential functional specialization:

  • Sequence Conservation:

    • High degree of sequence conservation exists between htpX from different Brucella species

    • B. melitensis biotype 1 (UniProt ID: Q8YJ50) and B. abortus (UniProt IDs: Q2YLH3, Q57B74) htpX proteins share identical amino acid sequences (325 amino acids)

    • This extreme conservation suggests critical functional importance and strong selective pressure to maintain protein structure and function

  • Structural Comparisons:

    • Available structural models from the SWISS-MODEL Repository (based on template 3cqb.1.A) show a QMEAN score of 0.60, indicating reliable structural prediction across Brucella species

    • The monomeric state appears to be conserved across species based on homology modeling

    • The high structural conservation further supports the essential nature of htpX function in Brucella biology

  • Comparative Expression Patterns:

    • Transcriptional profiling studies indicate that htpX expression patterns may differ between Brucella species during infection

    • B. melitensis invasive-associated gene expression has been studied in non-phagocytic host cells at 4 and 12 hours post-infection

    • Comparative expression studies across species could reveal species-specific regulatory mechanisms

  • Functional Variations:

    • Despite sequence conservation, subtle functional differences may exist between htpX homologs from different Brucella species

    • These differences might contribute to host specificity or tissue tropism observed between species

    • Experimental comparison of htpX mutants from different Brucella species in identical host cell systems would help elucidate any functional variations

Brucella SpeciesUniProt IDProtein LengthSequence Identity to B. melitensis htpX
B. melitensis biotype 1Q8YJ50325 aa100%
B. melitensis biotype 2C0RF64325 aa100%
B. abortusQ2YLH3325 aa100%
B. abortus biovar 1Q57B74325 aa100%

The remarkable conservation of htpX across Brucella species suggests it performs fundamental cellular functions that are essential across the genus, making it a potential target for broad-spectrum therapeutic approaches.

What are the optimal conditions for expressing and purifying recombinant Brucella htpX?

Optimizing the expression and purification of recombinant Brucella htpX requires careful consideration of several parameters:

  • Expression System Selection:

    • Recommended host: E. coli BL21(DE3) or similar strains optimized for recombinant protein expression

    • Vector considerations: Vectors with tightly controlled promoters (T7, tac) are preferable due to potential toxicity of overexpressed proteases

    • Fusion tags: N-terminal His-tag is commonly used and effective for purification; alternative tags (GST, MBP) may improve solubility but could affect enzymatic activity

  • Expression Optimization:

    • Induction parameters: Lower temperatures (16-20°C) during induction can improve proper folding of membrane proteins

    • Inducer concentration: Titrate IPTG concentrations (0.1-1.0 mM) to find optimal expression level that balances yield and solubility

    • Expression duration: Extended expression periods (16-20 hours) at lower temperatures often yield better results for membrane proteins

  • Extraction and Solubilization:

    • Membrane fraction isolation: Differential centrifugation to separate membrane fractions

    • Detergent selection: Test multiple detergents (DDM, LDAO, OG) for optimal solubilization while maintaining activity

    • Solubilization conditions: Buffer composition (pH 7.5-8.5), salt concentration (100-500 mM NaCl), and glycerol (5-10%) can significantly impact solubilization efficiency

  • Purification Strategy:

    • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA or similar resins

    • Secondary purification: Size exclusion chromatography to remove aggregates and ensure homogeneity

    • Buffer optimization: Tris/PBS-based buffer containing 6% trehalose at pH 8.0 has been validated for stability

  • Quality Control Metrics:

    • Purity assessment: SDS-PAGE analysis should confirm >90% purity

    • Activity assays: Develop specific protease activity assays to ensure functionality of purified protein

    • Structural integrity: Circular dichroism or thermal shift assays to assess proper folding

  • Storage Considerations:

    • Lyophilization: For long-term stability

    • Reconstitution: In deionized sterile water to 0.1-1.0 mg/mL

    • Cryopreservation: Addition of 5-50% glycerol before storage at -20°C/-80°C

    • Aliquoting: Create single-use aliquots to avoid freeze-thaw cycles

How can researchers effectively create and validate htpX mutants in Brucella?

Creating and validating htpX mutants in Brucella requires specialized approaches due to the pathogenic nature of the organism and the need for robust verification:

  • Mutant Generation Strategies:

    • Transposon mutagenesis: Random insertion can be effective for initial screening, using systems that have been validated in Brucella

    • Targeted deletion: Homologous recombination using suicide plasmids containing flanking regions of the htpX gene

    • CRISPR-Cas9 approaches: Newer methodologies adapted for Brucella can provide precise genetic modifications

    • Conditional mutants: Consider inducible systems for essential genes to study depletion effects

  • Selection and Screening Methods:

    • Antibiotic selection: Incorporate appropriate resistance markers (kanamycin at 100 μg/ml has been used successfully)

    • PCR verification: Design primers spanning deletion junctions to confirm gene removal

    • Whole genome sequencing: To verify clean deletions without unintended mutations elsewhere

    • Proteomic confirmation: Western blot or mass spectrometry to confirm absence of htpX protein

  • Phenotypic Validation:

    • Growth curves: Compare mutant and wild-type growth under standard and stress conditions

    • Stress susceptibility: Test responses to various stressors (oxidative stress, heat shock, nutrient limitation)

    • Cell culture infection models: Assess invasion and intracellular survival in both professional and non-professional phagocytes

    • Animal infection studies: Evaluate virulence in appropriate animal models

  • Complementation Studies:

    • Trans-complementation: Reintroduce the wild-type htpX gene on a plasmid

    • Chromosomal complementation: More stable approach for in vivo studies

    • Site-directed mutagenesis: Introduce specific mutations to identify critical residues

    • Heterologous complementation: Test functional conservation using htpX from other species

  • Transcriptional Analysis:

    • RNA-Seq: Compare global transcriptional profiles between mutant and wild-type

    • qRT-PCR: Validate expression changes in specific genes

    • Promoter reporter fusions: Monitor htpX expression under various conditions

  • Advanced Functional Characterization:

    • Proteomic profiling: Identify accumulated substrates in the absence of htpX

    • Subcellular localization: Determine if htpX mutation affects bacterial compartmentalization

    • Host response analysis: Evaluate changes in host cell responses to mutant vs. wild-type infection

What analytical techniques are most effective for studying htpX protein-protein interactions and substrates?

Understanding htpX protein-protein interactions and identifying its substrates requires sophisticated analytical approaches:

  • Substrate Identification Methodologies:

    • Comparative proteomics: Analysis of protein abundance differences between wild-type and htpX-deficient strains using quantitative mass spectrometry (MS)

    • SILAC (Stable Isotope Labeling with Amino acids in Cell culture): Differential labeling allows direct comparison between experimental conditions

    • Activity-based protein profiling: Using active site-directed probes to capture protease-substrate interactions

    • N-terminomics: Identifying new N-termini generated by proteolytic cleavage to map specific substrate processing events

  • Interaction Partner Discovery:

    • Affinity purification-mass spectrometry (AP-MS): Using tagged htpX to pull down interacting proteins

    • Bacterial two-hybrid systems: Adapted for membrane proteins to detect binary interactions

    • Cross-linking MS (XL-MS): Chemical cross-linking followed by MS identification of linked peptides

    • Proximity labeling: Using BioID or APEX2 fusions to label proteins in close proximity to htpX in vivo

  • Structural Analysis of Interactions:

    • Hydrogen-deuterium exchange MS (HDX-MS): Maps conformational changes and interaction interfaces

    • Cryo-electron microscopy: For visualization of larger complexes

    • NMR spectroscopy: For studying dynamics of interactions in solution

    • X-ray crystallography: For high-resolution structures of htpX-substrate complexes

  • Functional Validation of Interactions:

    • In vitro reconstitution: Purified components to verify direct interactions

    • Site-directed mutagenesis: Mutation of key residues to disrupt specific interactions

    • Domain mapping: Truncation constructs to identify interaction domains

    • Competition assays: Using peptides or small molecules to disrupt specific interactions

  • Temporal Dynamics Analysis:

    • Pulse-chase experiments: Track substrate degradation kinetics

    • Time-resolved proteomics: Sample collection at multiple time points during infection

    • Single-cell analysis: Monitoring protein-protein interactions during infection using fluorescence-based approaches

  • Computational Prediction and Modeling:

    • Substrate prediction algorithms: Based on known cleavage site preferences

    • Molecular docking: Predict potential binding orientations

    • Molecular dynamics simulations: Model dynamic interactions at atomic resolution

    • Network analysis: Integrate interaction data into larger cellular pathways

These methodologies can be combined in complementary approaches to build a comprehensive understanding of htpX interactions and substrates, thus elucidating its functional role in Brucella biology and pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.