Recombinant Brucella melitensis biotype 1 Protein CrcB homolog 1 (crcB1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Brucella melitensis biotype 1 Protein CrcB homolog 1 (crcB1)

Recombinant Brucella melitensis biotype 1 Protein CrcB homolog 1 (crcB1) is a recombinant protein derived from the bacterium Brucella melitensis, which is the causative agent of brucellosis, a zoonotic disease affecting humans and animals. The protein crcB1 is part of the CrcB family, which plays roles in bacterial physiology and pathogenesis. This article will delve into the characteristics, functions, and research findings related to crcB1.

Characteristics of Recombinant Brucella melitensis biotype 1 Protein CrcB homolog 1 (crcB1)

  • Protein Structure and Sequence: The crcB1 protein is composed of 123 amino acids. Its sequence starts with the amino acid sequence MWVGLGGGVGSLGRWWIGRIVGEYHHGAFPLGTFLINISGAFVIGYLSVLFGVDWHDRYGTM, indicating a specific structural arrangement that may be crucial for its function .

  • Production and Storage: The recombinant protein is typically produced in a laboratory setting and stored in a Tris-based buffer with 50% glycerol at -20°C to maintain stability .

Functions and Roles of crcB1

While specific functions of crcB1 in Brucella melitensis are not extensively detailed, proteins within the CrcB family often contribute to bacterial survival and adaptation within host environments. They may be involved in stress response, biofilm formation, or other mechanisms that enhance bacterial persistence.

Research Findings and Applications

Research on Brucella melitensis proteins like crcB1 is crucial for understanding the pathogenesis of brucellosis and developing diagnostic or therapeutic tools. Studies often focus on identifying proteins that could serve as targets for vaccine development or as markers for disease diagnosis.

AspectDescriptionRelevance
Protein SequenceMWVGLGGGVGSLGRWWIGRIVGEYHHGAFPLGTFLINISGAFVIGYLSVLFGVDWHDRYGTM...Essential for understanding protein structure and potential interactions.
Storage ConditionsTris-based buffer, 50% glycerol, -20°CMaintains protein stability for experimental use.
Potential FunctionsStress response, biofilm formation, pathogenesisImportant for understanding bacterial survival mechanisms.
Research ApplicationsDiagnostic markers, vaccine targetsCrucial for developing tools to combat brucellosis.

Challenges and Future Directions

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
crcB1; BMEI0633; Putative fluoride ion transporter CrcB 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-123
Protein Length
full length protein
Species
Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)
Target Names
crcB1
Target Protein Sequence
MWVGLGGGVGSLGRWWIGRIVGEYHHGAFPLGTFLINISGAFVIGYLSVLFGVDWHDRYG TMLNAGVLTGILGGYTTFSSMQLDAVKLSHKGQGGLAVFYLVASVLSGLFAAWLGAMLAH LQG
Uniprot No.

Target Background

Function
Crucial for reducing intracellular fluoride concentration and its associated toxicity.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the optimal conditions for purifying recombinant crcB1 protein while maintaining structural integrity?

Purification of recombinant crcB1 protein requires careful consideration of its membrane-associated nature. The optimal purification protocol involves cell lysis under gentle conditions (preferably using detergent-based methods rather than sonication) followed by immobilized metal affinity chromatography (IMAC) using the N-terminal His-tag. Buffer composition is critical, with recommended conditions including 20 mM Tris-HCl (pH 8.0), 300 mM NaCl, and a mild detergent like 0.1% DDM or 0.5% CHAPS to maintain the protein in solution. Elution should use an imidazole gradient (50-300 mM), with collected fractions immediately supplemented with 5-10% glycerol to improve stability. For long-term storage, lyophilization in a Tris/PBS-based buffer with 6% trehalose (pH 8.0) is recommended, followed by storage at -80°C . Size exclusion chromatography as a secondary purification step may improve homogeneity but carries the risk of reduced yield.

How can researchers effectively assess the fluoride transport function of crcB1 in experimental systems?

Researchers can assess the fluoride transport function of crcB1 through multiple complementary approaches. A primary method involves fluoride-sensitive electrode measurements in proteoliposomes reconstituted with purified crcB1. This direct biophysical approach allows quantification of fluoride transport rates under various conditions. Alternatively, genetic complementation assays using crcB-deficient E. coli strains grown on fluoride-containing media can demonstrate functional rescue. Fluorescence-based assays utilizing fluoride-sensitive probes can also be employed to monitor real-time transport in whole cells. For more detailed kinetic analysis, radioisotope (18F) uptake studies provide precise quantification of transport parameters. When designing these experiments, researchers should include appropriate controls, including known functional fluoride transporters (positive control) and inactive mutants of crcB1 (negative control).

What protocols are most effective for generating site-directed mutations in crcB1 to study structure-function relationships?

For generating site-directed mutations in crcB1, QuikChange mutagenesis or overlap extension PCR methods offer the most reliable results. When designing mutagenesis experiments, researchers should prioritize conserved residues identified through multiple sequence alignment of CrcB homologs across bacterial species. To systematically explore structure-function relationships, consider creating a mutation series targeting: (1) predicted pore-forming residues, (2) residues at the membrane interface, and (3) residues potentially involved in fluoride coordination. A comprehensive approach would include both conservative substitutions (maintaining similar physicochemical properties) and non-conservative changes. Following mutagenesis, each construct should undergo verification through sequencing before expression and functional assessment through transport assays as described above. This methodical approach allows mapping of critical functional regions within the crcB1 protein structure.

How might crcB1 contribute to antimicrobial resistance mechanisms in Brucella melitensis?

While crcB1 is not directly identified as a classical antimicrobial resistance gene, it may contribute to resistance mechanisms through several potential pathways. Similar to efflux pump systems identified in B. melitensis (such as bepC, bepD, bepE, bepF, and bepG), crcB1's ion transport function could potentially contribute to antimicrobial efflux, particularly for fluoride-containing compounds . Additionally, proteins involved in ion homeostasis often play roles in adaptation to environmental stressors, potentially contributing to the bacteria's ability to survive in the presence of antimicrobials. The complex interplay between membrane transporters and resistance mechanisms highlights the multifactorial basis of antimicrobial resistance in B. melitensis, where non-classical resistance genes may contribute significantly to the observed phenotypic resistance patterns .

What experimental approaches can determine if crcB1 mutations correlate with resistance to specific antimicrobials?

To investigate potential correlations between crcB1 mutations and antimicrobial resistance, researchers should implement a multi-faceted approach combining phenotypic and genotypic analyses. First, collect a diverse panel of B. melitensis isolates (20-30 strains) from various sources and perform standardized antimicrobial susceptibility testing against clinically relevant antibiotics including doxycycline, ciprofloxacin, cotrimoxazole, and rifampicin . Next, sequence the crcB1 gene from all isolates to identify naturally occurring polymorphisms. Perform statistical analysis to identify associations between specific mutations and resistance phenotypes. To establish causality, introduce identified mutations into susceptible strains using site-directed mutagenesis, followed by phenotypic testing. Complementary approaches should include transcriptomic and proteomic analyses to assess if crcB1 expression levels change in response to antimicrobial exposure. This comprehensive approach can help determine whether crcB1 mutations represent true resistance determinants or merely coincidental genetic variations.

How does crcB1 interact with known efflux systems such as bepC, bepD, bepE, bepF, and bepG in contributing to antimicrobial resistance?

The potential interaction between crcB1 and established efflux systems in B. melitensis represents a complex area of investigation requiring specialized experimental approaches. While direct protein-protein interactions between crcB1 and Bep efflux pumps have not been conclusively demonstrated, functional cooperation may occur at the level of membrane organization or through shared regulatory pathways . To investigate these interactions, researchers should employ bacterial two-hybrid assays to screen for direct protein interactions, followed by co-immunoprecipitation for validation. Fluorescence resonance energy transfer (FRET) using fluorescently tagged proteins can provide evidence of spatial proximity in the bacterial membrane. At the functional level, synergistic effects can be assessed by creating single and combination knockout mutants (ΔcrcB1, ΔbepC, ΔcrcB1ΔbepC, etc.) followed by antimicrobial susceptibility testing. If crcB1 and Bep systems operate in concert, combination mutants would show greater susceptibility than predicted by the individual mutations alone, suggesting functional cooperation in antimicrobial resistance.

How can recombinant crcB1 be incorporated into vaccine development strategies against brucellosis?

Utilizing recombinant crcB1 in vaccine development presents an innovative approach to brucellosis prevention. A promising strategy involves incorporating crcB1 into a recombinant subunit vaccine, potentially combined with other immunogenic Brucella proteins. For enhanced immunogenicity, crcB1 can be fused with immune-stimulating proteins such as the listeriolysin O (LLO) from Listeria monocytogenes, which has shown success in enhancing immune responses for B. abortus vaccines . Another approach involves generating a live attenuated B. melitensis strain that overexpresses crcB1, potentially altering the pathogen's ion homeostasis and consequently its virulence. For optimal antigen presentation, crcB1 can be expressed in vaccine vectors that promote CD8+ T-cell responses, crucial for protection against intracellular pathogens like Brucella. When testing these vaccine candidates, researchers should assess both humoral and cell-mediated immune responses, with particular attention to IFN-γ production, which correlates strongly with protection against brucellosis .

What role might crcB1 play in Brucella's survival within host macrophages during infection?

The potential role of crcB1 in intracellular survival represents a critical aspect of Brucella pathogenesis that warrants detailed investigation. During infection, Brucella species must adapt to the hostile environment of macrophage phagosomes, where ion concentrations fluctuate significantly. As a putative fluoride ion transporter, crcB1 likely contributes to maintaining ion homeostasis within this challenging niche. Experimental approaches to investigate this function should include creating crcB1 knockout mutants and assessing their survival in macrophage infection models compared to wild-type strains. Time-course experiments measuring bacterial burden, phagosome acidification, and ion concentrations would provide valuable insights. Additionally, fluorescence microscopy using tagged crcB1 protein could reveal its localization during different stages of intracellular infection. Transcriptomic analysis comparing gene expression in intracellular bacteria versus extracellular conditions would help determine if crcB1 expression is upregulated during macrophage invasion, suggesting a specific role in intracellular adaptation.

How can multi-omics approaches enhance our understanding of crcB1's role in the broader context of Brucella pathogenesis?

A multi-omics strategy offers the most comprehensive approach to contextualizing crcB1's role within Brucella pathogenesis. This integrative methodology should combine genomics, transcriptomics, proteomics, and metabolomics data to create a holistic understanding of crcB1 function. Starting with comparative genomics across Brucella species and strains, researchers can identify evolutionary patterns in crcB1 conservation and variation. RNA-Seq analysis under various stress conditions (including antimicrobial exposure, pH stress, and macrophage infection) can reveal condition-specific regulation of crcB1 expression . Proteomics approaches, particularly proximity-based labeling techniques like BioID, can identify the protein interaction network surrounding crcB1. Metabolomics analysis comparing wild-type and crcB1 mutant strains can reveal downstream metabolic consequences of altered ion transport. Integration of these multi-omics datasets through network analysis algorithms can identify previously unrecognized functional connections between crcB1 and virulence mechanisms, potentially revealing novel therapeutic targets against brucellosis.

What are common challenges in expressing recombinant crcB1 and how can they be overcome?

Researchers frequently encounter several challenges when expressing recombinant crcB1, primarily due to its membrane-associated nature. Protein misfolding and aggregation represent the most common issues, often resulting in inclusion body formation. To address this, expression conditions should be optimized by reducing induction temperature to 16-18°C and IPTG concentration to 0.1-0.3 mM. Utilizing specialized E. coli strains like C41(DE3) or C43(DE3), which are engineered for membrane protein expression, can significantly improve yields of properly folded protein. Inclusion of molecular chaperones (via co-expression of GroEL/GroES) may further enhance correct folding. For proteins that consistently form inclusion bodies, refolding protocols using gradual dialysis with decreasing urea concentrations while introducing appropriate detergents can recover functional protein. Alternatively, cell-free expression systems may circumvent cellular toxicity issues. Finally, fusion partners like MBP (maltose-binding protein) or SUMO can improve solubility, with the fusion tag subsequently removed using specific proteases.

How can researchers address the issue of sequence polymorphisms when working with crcB1 from field isolates?

Working with crcB1 from field isolates introduces challenges related to sequence polymorphisms that can impact experimental reproducibility. To address this systematically, researchers should first sequence the crcB1 gene from multiple isolates to establish a polymorphism database, identifying conserved and variable regions. When designing experiments, primers and probes should target highly conserved regions to ensure consistent amplification across isolates. For functional studies, consider creating a reference panel of recombinant proteins representing major variant types to assess functional differences. When publishing results, it's essential to clearly report the specific sequence variant used, preferably with reference to a public database accession number. For vaccine or diagnostic development, epitope mapping studies should identify conserved epitopes present across variants. Additionally, the development of degenerate primers accommodating known polymorphic sites can facilitate consistent amplification from diverse field isolates, ensuring more robust and generalizable research outcomes across different B. melitensis strains.

What approaches can resolve contradictory data when comparing phenotypic antimicrobial resistance with genetic markers in crcB1?

Resolving contradictions between phenotypic antimicrobial resistance and genetic markers in crcB1 requires a systematic investigation approach. First, researchers should validate both phenotypic and genotypic methodologies to rule out technical errors. For phenotypic testing, use standardized methodologies like broth microdilution following CLSI guidelines with appropriate quality controls. For genotyping, confirm sequencing results through bidirectional sequencing and consider deep sequencing to detect subpopulations with different alleles. Next, expand the genetic analysis beyond crcB1 to include other potential resistance determinants, as antimicrobial resistance in B. melitensis often involves multiple genetic factors working in concert . Time-kill assays and population analysis profiling can help identify heteroresistance phenomena where a subpopulation of bacteria displays resistance despite susceptible genotypes. Additionally, epigenetic factors and post-transcriptional regulation should be investigated through methylome analysis and RNA-Seq. This comprehensive approach acknowledges the complex relationship between genotype and phenotype in antimicrobial resistance, as highlighted by studies showing that mutations in AMR-associated genes do not consistently align with phenotypic resistance .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.