Recombinant Brucella melitensis biotype 1 Protein CrcB homolog 1 (crcB1) is a recombinant protein derived from the bacterium Brucella melitensis, which is the causative agent of brucellosis, a zoonotic disease affecting humans and animals. The protein crcB1 is part of the CrcB family, which plays roles in bacterial physiology and pathogenesis. This article will delve into the characteristics, functions, and research findings related to crcB1.
Protein Structure and Sequence: The crcB1 protein is composed of 123 amino acids. Its sequence starts with the amino acid sequence MWVGLGGGVGSLGRWWIGRIVGEYHHGAFPLGTFLINISGAFVIGYLSVLFGVDWHDRYGTM, indicating a specific structural arrangement that may be crucial for its function .
Production and Storage: The recombinant protein is typically produced in a laboratory setting and stored in a Tris-based buffer with 50% glycerol at -20°C to maintain stability .
While specific functions of crcB1 in Brucella melitensis are not extensively detailed, proteins within the CrcB family often contribute to bacterial survival and adaptation within host environments. They may be involved in stress response, biofilm formation, or other mechanisms that enhance bacterial persistence.
Research on Brucella melitensis proteins like crcB1 is crucial for understanding the pathogenesis of brucellosis and developing diagnostic or therapeutic tools. Studies often focus on identifying proteins that could serve as targets for vaccine development or as markers for disease diagnosis.
| Aspect | Description | Relevance |
|---|---|---|
| Protein Sequence | MWVGLGGGVGSLGRWWIGRIVGEYHHGAFPLGTFLINISGAFVIGYLSVLFGVDWHDRYGTM... | Essential for understanding protein structure and potential interactions. |
| Storage Conditions | Tris-based buffer, 50% glycerol, -20°C | Maintains protein stability for experimental use. |
| Potential Functions | Stress response, biofilm formation, pathogenesis | Important for understanding bacterial survival mechanisms. |
| Research Applications | Diagnostic markers, vaccine targets | Crucial for developing tools to combat brucellosis. |
KEGG: bme:BMEI0633
STRING: 224914.BAWG_2609
Purification of recombinant crcB1 protein requires careful consideration of its membrane-associated nature. The optimal purification protocol involves cell lysis under gentle conditions (preferably using detergent-based methods rather than sonication) followed by immobilized metal affinity chromatography (IMAC) using the N-terminal His-tag. Buffer composition is critical, with recommended conditions including 20 mM Tris-HCl (pH 8.0), 300 mM NaCl, and a mild detergent like 0.1% DDM or 0.5% CHAPS to maintain the protein in solution. Elution should use an imidazole gradient (50-300 mM), with collected fractions immediately supplemented with 5-10% glycerol to improve stability. For long-term storage, lyophilization in a Tris/PBS-based buffer with 6% trehalose (pH 8.0) is recommended, followed by storage at -80°C . Size exclusion chromatography as a secondary purification step may improve homogeneity but carries the risk of reduced yield.
Researchers can assess the fluoride transport function of crcB1 through multiple complementary approaches. A primary method involves fluoride-sensitive electrode measurements in proteoliposomes reconstituted with purified crcB1. This direct biophysical approach allows quantification of fluoride transport rates under various conditions. Alternatively, genetic complementation assays using crcB-deficient E. coli strains grown on fluoride-containing media can demonstrate functional rescue. Fluorescence-based assays utilizing fluoride-sensitive probes can also be employed to monitor real-time transport in whole cells. For more detailed kinetic analysis, radioisotope (18F) uptake studies provide precise quantification of transport parameters. When designing these experiments, researchers should include appropriate controls, including known functional fluoride transporters (positive control) and inactive mutants of crcB1 (negative control).
For generating site-directed mutations in crcB1, QuikChange mutagenesis or overlap extension PCR methods offer the most reliable results. When designing mutagenesis experiments, researchers should prioritize conserved residues identified through multiple sequence alignment of CrcB homologs across bacterial species. To systematically explore structure-function relationships, consider creating a mutation series targeting: (1) predicted pore-forming residues, (2) residues at the membrane interface, and (3) residues potentially involved in fluoride coordination. A comprehensive approach would include both conservative substitutions (maintaining similar physicochemical properties) and non-conservative changes. Following mutagenesis, each construct should undergo verification through sequencing before expression and functional assessment through transport assays as described above. This methodical approach allows mapping of critical functional regions within the crcB1 protein structure.
While crcB1 is not directly identified as a classical antimicrobial resistance gene, it may contribute to resistance mechanisms through several potential pathways. Similar to efflux pump systems identified in B. melitensis (such as bepC, bepD, bepE, bepF, and bepG), crcB1's ion transport function could potentially contribute to antimicrobial efflux, particularly for fluoride-containing compounds . Additionally, proteins involved in ion homeostasis often play roles in adaptation to environmental stressors, potentially contributing to the bacteria's ability to survive in the presence of antimicrobials. The complex interplay between membrane transporters and resistance mechanisms highlights the multifactorial basis of antimicrobial resistance in B. melitensis, where non-classical resistance genes may contribute significantly to the observed phenotypic resistance patterns .
To investigate potential correlations between crcB1 mutations and antimicrobial resistance, researchers should implement a multi-faceted approach combining phenotypic and genotypic analyses. First, collect a diverse panel of B. melitensis isolates (20-30 strains) from various sources and perform standardized antimicrobial susceptibility testing against clinically relevant antibiotics including doxycycline, ciprofloxacin, cotrimoxazole, and rifampicin . Next, sequence the crcB1 gene from all isolates to identify naturally occurring polymorphisms. Perform statistical analysis to identify associations between specific mutations and resistance phenotypes. To establish causality, introduce identified mutations into susceptible strains using site-directed mutagenesis, followed by phenotypic testing. Complementary approaches should include transcriptomic and proteomic analyses to assess if crcB1 expression levels change in response to antimicrobial exposure. This comprehensive approach can help determine whether crcB1 mutations represent true resistance determinants or merely coincidental genetic variations.
The potential interaction between crcB1 and established efflux systems in B. melitensis represents a complex area of investigation requiring specialized experimental approaches. While direct protein-protein interactions between crcB1 and Bep efflux pumps have not been conclusively demonstrated, functional cooperation may occur at the level of membrane organization or through shared regulatory pathways . To investigate these interactions, researchers should employ bacterial two-hybrid assays to screen for direct protein interactions, followed by co-immunoprecipitation for validation. Fluorescence resonance energy transfer (FRET) using fluorescently tagged proteins can provide evidence of spatial proximity in the bacterial membrane. At the functional level, synergistic effects can be assessed by creating single and combination knockout mutants (ΔcrcB1, ΔbepC, ΔcrcB1ΔbepC, etc.) followed by antimicrobial susceptibility testing. If crcB1 and Bep systems operate in concert, combination mutants would show greater susceptibility than predicted by the individual mutations alone, suggesting functional cooperation in antimicrobial resistance.
Utilizing recombinant crcB1 in vaccine development presents an innovative approach to brucellosis prevention. A promising strategy involves incorporating crcB1 into a recombinant subunit vaccine, potentially combined with other immunogenic Brucella proteins. For enhanced immunogenicity, crcB1 can be fused with immune-stimulating proteins such as the listeriolysin O (LLO) from Listeria monocytogenes, which has shown success in enhancing immune responses for B. abortus vaccines . Another approach involves generating a live attenuated B. melitensis strain that overexpresses crcB1, potentially altering the pathogen's ion homeostasis and consequently its virulence. For optimal antigen presentation, crcB1 can be expressed in vaccine vectors that promote CD8+ T-cell responses, crucial for protection against intracellular pathogens like Brucella. When testing these vaccine candidates, researchers should assess both humoral and cell-mediated immune responses, with particular attention to IFN-γ production, which correlates strongly with protection against brucellosis .
The potential role of crcB1 in intracellular survival represents a critical aspect of Brucella pathogenesis that warrants detailed investigation. During infection, Brucella species must adapt to the hostile environment of macrophage phagosomes, where ion concentrations fluctuate significantly. As a putative fluoride ion transporter, crcB1 likely contributes to maintaining ion homeostasis within this challenging niche. Experimental approaches to investigate this function should include creating crcB1 knockout mutants and assessing their survival in macrophage infection models compared to wild-type strains. Time-course experiments measuring bacterial burden, phagosome acidification, and ion concentrations would provide valuable insights. Additionally, fluorescence microscopy using tagged crcB1 protein could reveal its localization during different stages of intracellular infection. Transcriptomic analysis comparing gene expression in intracellular bacteria versus extracellular conditions would help determine if crcB1 expression is upregulated during macrophage invasion, suggesting a specific role in intracellular adaptation.
A multi-omics strategy offers the most comprehensive approach to contextualizing crcB1's role within Brucella pathogenesis. This integrative methodology should combine genomics, transcriptomics, proteomics, and metabolomics data to create a holistic understanding of crcB1 function. Starting with comparative genomics across Brucella species and strains, researchers can identify evolutionary patterns in crcB1 conservation and variation. RNA-Seq analysis under various stress conditions (including antimicrobial exposure, pH stress, and macrophage infection) can reveal condition-specific regulation of crcB1 expression . Proteomics approaches, particularly proximity-based labeling techniques like BioID, can identify the protein interaction network surrounding crcB1. Metabolomics analysis comparing wild-type and crcB1 mutant strains can reveal downstream metabolic consequences of altered ion transport. Integration of these multi-omics datasets through network analysis algorithms can identify previously unrecognized functional connections between crcB1 and virulence mechanisms, potentially revealing novel therapeutic targets against brucellosis.
Researchers frequently encounter several challenges when expressing recombinant crcB1, primarily due to its membrane-associated nature. Protein misfolding and aggregation represent the most common issues, often resulting in inclusion body formation. To address this, expression conditions should be optimized by reducing induction temperature to 16-18°C and IPTG concentration to 0.1-0.3 mM. Utilizing specialized E. coli strains like C41(DE3) or C43(DE3), which are engineered for membrane protein expression, can significantly improve yields of properly folded protein. Inclusion of molecular chaperones (via co-expression of GroEL/GroES) may further enhance correct folding. For proteins that consistently form inclusion bodies, refolding protocols using gradual dialysis with decreasing urea concentrations while introducing appropriate detergents can recover functional protein. Alternatively, cell-free expression systems may circumvent cellular toxicity issues. Finally, fusion partners like MBP (maltose-binding protein) or SUMO can improve solubility, with the fusion tag subsequently removed using specific proteases.
Working with crcB1 from field isolates introduces challenges related to sequence polymorphisms that can impact experimental reproducibility. To address this systematically, researchers should first sequence the crcB1 gene from multiple isolates to establish a polymorphism database, identifying conserved and variable regions. When designing experiments, primers and probes should target highly conserved regions to ensure consistent amplification across isolates. For functional studies, consider creating a reference panel of recombinant proteins representing major variant types to assess functional differences. When publishing results, it's essential to clearly report the specific sequence variant used, preferably with reference to a public database accession number. For vaccine or diagnostic development, epitope mapping studies should identify conserved epitopes present across variants. Additionally, the development of degenerate primers accommodating known polymorphic sites can facilitate consistent amplification from diverse field isolates, ensuring more robust and generalizable research outcomes across different B. melitensis strains.
Resolving contradictions between phenotypic antimicrobial resistance and genetic markers in crcB1 requires a systematic investigation approach. First, researchers should validate both phenotypic and genotypic methodologies to rule out technical errors. For phenotypic testing, use standardized methodologies like broth microdilution following CLSI guidelines with appropriate quality controls. For genotyping, confirm sequencing results through bidirectional sequencing and consider deep sequencing to detect subpopulations with different alleles. Next, expand the genetic analysis beyond crcB1 to include other potential resistance determinants, as antimicrobial resistance in B. melitensis often involves multiple genetic factors working in concert . Time-kill assays and population analysis profiling can help identify heteroresistance phenomena where a subpopulation of bacteria displays resistance despite susceptible genotypes. Additionally, epigenetic factors and post-transcriptional regulation should be investigated through methylome analysis and RNA-Seq. This comprehensive approach acknowledges the complex relationship between genotype and phenotype in antimicrobial resistance, as highlighted by studies showing that mutations in AMR-associated genes do not consistently align with phenotypic resistance .