Recombinant Brucella melitensis biotype 1 Protein CrcB homolog 2 (crcB2)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Brucella melitensis biotype 1 Protein CrcB homolog 2 (crcB2) is a bacterially expressed protein derived from the pathogenic Gram-negative bacterium Brucella melitensis, a causative agent of brucellosis. This recombinant protein is primarily utilized in immunological assays such as ELISA for diagnostic or research purposes .

Table 1: Key Biochemical Properties

PropertyDetails
Expression SystemEscherichia coli (recombinant)
TagDetermined during production (commonly His-tag for purification)
Storage BufferTris-based buffer with 50% glycerol
Storage Temperature-20°C (short-term); -80°C (long-term)
Sequence FeaturesTransmembrane helices, conserved CrcB-family motifs

Immunogenicity and Diagnostic Potential

  • ELISA Applications: Recombinant crcB2 is marketed as an antigen for antibody detection in brucellosis serodiagnosis .

  • Comparative Performance: Similar recombinant proteins (e.g., Omp28, VirB12) show sensitivities of 82–97% in ELISA formats, suggesting crcB2 could align with these benchmarks .

Table 2: Comparison with Other Brucella Recombinant Antigens

ProteinSensitivity (%)Specificity (%)ApplicationSource
crcB2Data pendingData pendingELISA, research
rOmp2897.585.6Serodiagnosis
VirB1287.894.0Differential diagnosis
Omp3190.0*92.4*Subunit vaccine candidate

*Values from animal studies.

Current Applications

  • Diagnostic Tools: Used in research-grade ELISA kits to detect anti-Brucella antibodies .

  • Vaccine Development: While not yet tested as a subunit vaccine, fusion proteins combining outer membrane proteins (e.g., Omp10-Omp28-L7/L12) show promise in eliciting Th1 immune responses .

Challenges and Opportunities

  • Cross-Reactivity: Like other Brucella proteins, crcB2 may cross-react with antibodies targeting LPS or homologous proteins in other Gram-negative bacteria .

  • Functional Studies: Genome-wide Tn-seq analyses highlight crcB2 as non-essential for in vitro growth but potentially critical under stress conditions .

Future Directions

  • Validation Studies: Large-scale clinical trials to assess crcB2’s diagnostic accuracy in human and veterinary settings.

  • Mechanistic Insights: Structural studies to elucidate its role in bacterial stress adaptation and host-pathogen interactions.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery information.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipment is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize development of the specified tag.
Synonyms
crcB2; BMEI0634; Putative fluoride ion transporter CrcB 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)
Target Names
crcB2
Target Protein Sequence
MLDIIILVVIGGAFGAMTREFIMLMVPPLTDGFPLDILVANVVACFLLGTVTALYARKIH SRDVHTIIGTGMMGGVSTFSSFAYGSVVLASASVSAFLIAAAYVTVSVVAGYVAVLAGMK FGEKSADILHRYPPMASIIDSGLVTVESRHSVAETIERVAAKAKSMGMNVFTRVDHGAGA KEAGLGLPPTELIIFGNPQNGTVLMQDKRTIGLDLPIRALAWEDGSGKVWLTVNDPAWLA QRHSLGLSSDVAIKAMVTGTGTVTKYAAGD
Uniprot No.

Target Background

Function
CrcB2 plays a crucial role in reducing fluoride concentration within cells, mitigating its toxicity.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of CrcB homolog 2 in Brucella melitensis pathogenesis?

CrcB homolog 2 in Brucella melitensis is implicated in bacterial survival mechanisms during host infection. While specific pathway details remain under investigation, current research suggests its involvement in fluoride ion channel functionality and potential roles in membrane integrity maintenance. The protein likely contributes to Brucella's ability to survive intracellularly, particularly in environments where ion homeostasis is critical for bacterial persistence. Research has demonstrated that Brucella species establish complex interactions with host immune responses, as evidenced by their modulation of chemokine production, including CXCL1 and CXCL2, which participate in neutrophil recruitment during infection . These chemokines signal through receptors such as CXCR2, which plays a critical role in orchestrating inflammatory responses during brucellosis.

How does recombinant CrcB homolog 2 differ structurally from native protein in Brucella melitensis biotype 1?

Recombinant CrcB homolog 2 typically maintains the core structural elements of the native protein while incorporating modifications that facilitate laboratory study. These modifications commonly include affinity tags (histidine tags being most prevalent) at either the N- or C-terminus to enable purification through metal affinity chromatography. Expression systems used for producing recombinant CrcB homolog 2 may introduce minor conformational differences compared to the native protein, particularly in post-translational modifications. Researchers should consider that while E. coli-expressed recombinant proteins offer high yields, they may lack Brucella-specific modifications that could influence protein function. Experimental validation using multiple approaches is necessary to confirm structural consistency between recombinant and native forms.

What culture conditions optimize expression of CrcB homolog 2 in laboratory settings?

Optimal culture conditions for CrcB homolog 2 expression parallel those used for other Brucella proteins. For native expression studies, Brucella requires specialized media with appropriate growth supplements. For recombinant protein production, expression systems utilizing E. coli BL21(DE3) grown in Luria-Bertani medium supplemented with appropriate antibiotics at 37°C until reaching mid-log phase (OD600 ≈ 0.6-0.8) followed by induction with IPTG (typically 0.5-1.0 mM) at reduced temperatures (16-25°C) for 16-18 hours generally produces optimal yields. The precise culture conditions should be experimentally determined, as CrcB homolog 2 has specific solubility characteristics that may require optimization. Colonial morphology of Brucella melitensis biotype 1 typically appears as round, 1-2 mm diameter colonies with smooth margins after 3-4 days incubation, appearing translucent with a pale honey color when viewed through the medium .

What are the recommended purification techniques for recombinant CrcB homolog 2 that maintain protein functionality?

Purification of recombinant CrcB homolog 2 requires careful consideration of the protein's membrane-associated characteristics. A systematic approach involves:

  • Initial purification using immobilized metal affinity chromatography (IMAC) if the recombinant protein contains a histidine tag

  • Secondary purification via size exclusion chromatography to remove aggregates and contaminants

  • Optional ion exchange chromatography depending on the isoelectric point of CrcB homolog 2

For membrane-associated proteins like CrcB homolog 2, inclusion of appropriate detergents is critical. A typical buffer system might include:

Purification StageBuffer CompositionDetergentNotes
Cell Lysis50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 1 mM PMSF1% Triton X-100Mechanical disruption preferred
IMAC50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol0.1% DDM20-250 mM imidazole gradient
Size Exclusion20 mM Tris-HCl pH 7.5, 150 mM NaCl0.05% DDMSuperdex 200 column

Functionality assessment post-purification should include ion channel activity assays, as CrcB homologs are typically involved in fluoride ion transport. The purification protocol should be validated by assessing protein purity through SDS-PAGE and Western blotting using antibodies specific to CrcB homolog 2 or its affinity tag.

What immunological methods are most effective for detecting CrcB homolog 2 in infected tissues?

Detection of CrcB homolog 2 in infected tissues presents significant challenges due to potential low expression levels. A multi-modal approach yields the most reliable results:

For immunohistochemistry, tissue samples should undergo standard fixation protocols (4% paraformaldehyde), followed by antigen retrieval using citrate buffer (pH 6.0) at 95°C for 20 minutes. Custom polyclonal antibodies raised against purified recombinant CrcB homolog 2 have shown superior specificity compared to commercial options. Detection systems utilizing horseradish peroxidase-conjugated secondary antibodies with 3,3'-diaminobenzidine (DAB) substrate provide optimal visualization.

For immunofluorescence, tyramide signal amplification techniques significantly enhance sensitivity. Confocal microscopy using Z-stack acquisition allows three-dimensional localization of CrcB homolog 2 within infected cells.

Western blotting from tissue homogenates requires careful optimization of extraction conditions, particularly detergent selection for this membrane-associated protein. Sample preparation critically influences detection sensitivity, with RIPA buffer (supplemented with protease inhibitors) yielding the most consistent results when tissues are processed within 2 hours of collection and kept at 4°C throughout processing.

The specificity of antibody-based detection methods should be validated using knockout controls or competitive binding assays with purified recombinant protein. While these immunological approaches are valuable, they should be supplemented with genomic or transcriptomic data to provide comprehensive evidence of CrcB homolog 2 presence in infected tissues.

How can researchers quantify CrcB homolog 2 expression levels in different Brucella melitensis growth phases?

Accurate quantification of CrcB homolog 2 expression across different growth phases requires integration of multiple analytical techniques:

For transcriptional analysis, quantitative real-time PCR (qRT-PCR) using primers specifically designed for crcB2 gene provides the most sensitive detection. Reference genes for normalization should be carefully selected based on expression stability across growth phases, with 16S rRNA and rpoB generally showing consistent expression in Brucella species. RNA extraction protocols must be optimized to maximize yield while minimizing degradation, particularly during stationary phase when RNA stability may be compromised.

For protein-level quantification, targeted mass spectrometry approaches such as multiple reaction monitoring (MRM) or parallel reaction monitoring (PRM) offer superior sensitivity and specificity compared to traditional Western blotting, particularly for membrane proteins like CrcB homolog 2. Stable isotope-labeled peptide standards corresponding to unique regions of CrcB homolog 2 enable absolute quantification.

A comprehensive expression profile should include measurements at multiple time points:

  • Early logarithmic phase (OD600 ≈ 0.2-0.3)

  • Mid-logarithmic phase (OD600 ≈ 0.6-0.8)

  • Late logarithmic phase (OD600 ≈ 1.0-1.2)

  • Early stationary phase (12-24 hours post-logarithmic)

  • Late stationary phase (48-72 hours post-logarithmic)

Data should be presented as fold-change relative to a reference point (typically early logarithmic phase) to facilitate interpretation of dynamic expression patterns. Environmental stressors relevant to host environments (pH changes, oxidative stress, nutrient limitation) should be incorporated into experimental designs to model in vivo conditions.

How does CrcB homolog 2 contribute to Brucella melitensis survival within macrophages?

CrcB homolog 2 likely contributes to Brucella melitensis intramacrophage survival through ion homeostasis regulation, particularly fluoride ion efflux. This function becomes crucial in the acidified environment of phagosomes where ion concentrations fluctuate significantly. The protein may be part of a broader stress response system that maintains bacterial membrane integrity during intracellular residency.

To experimentally determine CrcB homolog 2's contribution to intramacrophage survival, researchers should implement a systematic approach:

  • Generate crcB2 deletion mutants using allelic exchange techniques

  • Conduct comparative survival assays in macrophage cell lines (RAW264.7, J774.A1) and primary macrophages

  • Monitor bacterial replication at multiple timepoints (4, 24, 48, and 72 hours post-infection)

  • Assess phagosome acidification, ion concentration, and membrane integrity in wild-type versus mutant strains

  • Complement mutants with functional crcB2 to confirm phenotypic reversion

The intracellular trafficking of Brucella is complex and involves evasion of host defense mechanisms. Research has shown that Brucella species interact with host immune signaling pathways, affecting the production of chemokines like CXCL1 and CXCL2, which are ligands for CXCR2 receptors . These interactions contribute to the recruitment of neutrophils and the development of inflammatory responses during infection. Understanding how CrcB homolog 2 interfaces with these host-pathogen interactions provides valuable insights into Brucella virulence mechanisms.

What experimental models best demonstrate the immunogenic properties of recombinant CrcB homolog 2?

Evaluating the immunogenic properties of recombinant CrcB homolog 2 requires carefully selected experimental models that balance physiological relevance with experimental tractability. The following approach provides comprehensive immunogenicity assessment:

In vitro models:

  • Dendritic cell activation assays measuring upregulation of CD80, CD86, and MHC-II

  • Cytokine profiling from stimulated peripheral blood mononuclear cells (focus on IL-12, TNF-α, IFN-γ)

  • T-cell proliferation assays using CFSE-labeled lymphocytes

  • Analysis of T-cell polarization (Th1/Th2/Th17) through flow cytometry

In vivo models:

  • BALB/c mice represent a conventional model for brucellosis studies

  • IFN-γ-deficient mice provide an enhanced disease model with pronounced inflammation

  • Assessment of antibody responses (IgG1/IgG2a ratio) as indicator of Th1/Th2 bias

Experimental designs should include appropriate controls:

  • Adjuvant-only groups

  • Irrelevant recombinant protein with similar purification approach

  • Heat-denatured CrcB homolog 2 to distinguish conformational from linear epitopes

When analyzing immune responses, researchers should consider that CrcB homolog 2's membrane localization may affect its presentation to the immune system. Surface-exposed regions likely trigger stronger antibody responses, while internal epitopes may drive T-cell responses following processing. Experimental models should incorporate this compartmentalization when interpreting results.

The findings should be placed within the context of established host-pathogen interactions in brucellosis. Research indicates that CXCR2 plays a pivotal role in neutrophil recruitment and inflammation during Brucella infection , suggesting that immune modulation strategies targeting these pathways may be particularly relevant for vaccine development.

How does fluoride ion transport capability of CrcB homolog 2 relate to virulence in different animal models?

The fluoride ion transport capability of CrcB homolog 2 presents an intriguing connection to Brucella melitensis virulence across different animal models. This relationship can be systematically explored through comparative studies:

Fluoride transport quantification methods:

  • Fluoride-sensitive electrode measurements in bacterial suspensions

  • Fluorescence-based assays using ion-sensitive probes

  • Radiolabeled fluoride uptake/efflux kinetics

Animal models with varying susceptibility:

  • Mice (BALB/c): Standard model with moderate susceptibility

  • Guinea pigs: High susceptibility model

  • Ruminants: Natural host model with chronic infection

A comprehensive experimental approach should examine:

  • Correlation between fluoride transport efficiency and bacterial loads in different tissues

  • Impact of environmental fluoride concentrations on in vivo bacterial fitness

  • Comparative virulence of wild-type versus crcB2 mutants across multiple host species

  • Adaptation of fluoride transport activity under different host microenvironments

The table below summarizes expected phenotypic differences between wild-type and crcB2-deficient strains across different model systems:

Model SystemExpected Phenotype in Wild-TypeExpected Phenotype in crcB2 Mutant
BALB/c MiceChronic infection with steady bacterial loadsReduced persistence in spleen and liver
IFN-γ-deficient MiceSevere arthritis with high bacterial loadsAttenuated inflammatory response, similar to CXCR2-deficient phenotype
Cell Culture (Macrophages)Efficient replication in Brucella-containing vacuoleCompromised intracellular survival under fluoride stress

Research has demonstrated that susceptibility to Brucella-induced inflammation varies significantly between genetic backgrounds. For instance, studies show that IFN-γ-deficient mice develop severe osteoarticular and musculoskeletal inflammation upon Brucella infection, with markedly increased levels of chemokine receptors including CXCR2 . The intersection between ion transport functions and inflammatory signaling pathways represents a promising area for further investigation.

How can structural biology approaches elucidate CrcB homolog 2 fluoride transport mechanisms?

Elucidating the structural basis of CrcB homolog 2's fluoride transport function requires integration of multiple structural biology techniques, each with specific advantages for membrane protein analysis:

X-ray crystallography presents challenges for membrane proteins like CrcB homolog 2, but lipidic cubic phase (LCP) crystallization has proven successful for similar ion transporters. Crystallization trials should include detergent screening (DDM, LMNG, UDM) and LCP conditions with monoolein or related lipids. Microcrystals may be suitable for serial crystallography at X-ray free-electron lasers (XFEL) to minimize radiation damage.

Cryo-electron microscopy (cryo-EM) has revolutionized membrane protein structural biology. For CrcB homolog 2, which likely forms oligomeric assemblies, single-particle cryo-EM offers advantages despite its relatively small size (~20-25 kDa per monomer). Amphipol A8-35 or nanodiscs containing MSP1D1 and POPC:POPG lipids (3:1 ratio) have shown promise for preserving membrane protein structure during vitrification.

Nuclear magnetic resonance (NMR) spectroscopy provides dynamic information crucial for understanding transport mechanisms. While challenging for full-length membrane proteins, selective isotopic labeling (15N, 13C) of specific residues hypothesized to be involved in fluoride coordination can provide targeted structural insights. Solution NMR using detergent micelles or solid-state NMR in lipid bilayers each offer complementary information.

Molecular dynamics simulations bridge experimental structures and functional mechanisms. Simulations should model CrcB homolog 2 in a mixed lipid bilayer representing the Brucella membrane composition, with explicit water and ions. Fluoride transport pathways can be identified using techniques such as umbrella sampling to calculate potential of mean force.

Functional validation of structural insights should employ site-directed mutagenesis targeting:

  • Putative fluoride coordination sites

  • Channel-lining residues

  • Oligomerization interfaces

  • Conformational "hinge" regions

The structural features identified in these studies should be compared with homologous proteins in other pathogens to identify conserved mechanisms that might represent broader therapeutic targets.

What are the implications of CrcB homolog 2 genetic polymorphisms on brucellosis treatment outcomes?

Genetic polymorphisms in CrcB homolog 2 may significantly impact brucellosis treatment outcomes through several mechanisms that warrant systematic investigation:

Antibiotic interaction: CrcB homolog 2 polymorphisms could alter bacterial membrane permeability or efflux capabilities, affecting intracellular antibiotic concentrations. This is particularly relevant for brucellosis treatment, which typically involves prolonged combination therapy with doxycycline and an aminoglycoside or rifampin. Researchers should investigate:

  • Minimum inhibitory concentration (MIC) variations across clinical isolates with documented crcB2 polymorphisms

  • Antibiotic accumulation studies using radiolabeled compounds in isogenic strains differing only in crcB2 sequence

  • Treatment failure rates correlated with specific polymorphic variants

Host-pathogen interaction: Sequence variations in CrcB homolog 2 may affect recognition by host immune components, potentially influencing:

  • Pattern recognition receptor binding and downstream signaling

  • Antigen presentation efficiency

  • Immune evasion capabilities

Virulence modulation: Certain polymorphisms might enhance or reduce virulence through altered ion homeostasis mechanisms. This could manifest as:

  • Changed intracellular survival capabilities

  • Altered inflammatory response profiles

  • Modified tissue tropism patterns

A comprehensive approach should combine:

  • Genome-wide association studies (GWAS) from clinical isolates with documented treatment outcomes

  • Experimental evolution studies under antibiotic pressure to identify adaptive mutations

  • Isogenic strain comparisons in cellular and animal models

Research has demonstrated that the inflammatory response in brucellosis involves complex interactions between bacterial factors and host immune components. For instance, studies have shown that CXCR2 deficiency results in reduced neutrophil recruitment and inflammation in Brucella-infected tissues . Understanding how CrcB homolog 2 polymorphisms might influence these inflammatory pathways could provide insights into disease progression and treatment response variability.

How does CrcB homolog 2 interact with other membrane proteins in the Brucella melitensis envelope?

Understanding the interactome of CrcB homolog 2 within the complex environment of the Brucella melitensis envelope requires multi-faceted approaches that preserve native interactions:

Proximity-based labeling techniques such as BioID or APEX2 offer advantages for capturing transient or weak interactions in the native membrane environment. By fusing these enzymes to CrcB homolog 2, researchers can biotinylate nearby proteins for subsequent purification and identification by mass spectrometry. This approach should be implemented in both laboratory culture conditions and during macrophage infection to capture context-dependent interactions.

Crosslinking mass spectrometry (XL-MS) provides spatial constraints between interacting proteins. Chemical crosslinkers with varying spacer lengths (DSS, BS3, EDC) can capture different interaction distances. For membrane proteins like CrcB homolog 2, membrane-permeable crosslinkers should be prioritized.

Co-immunoprecipitation (Co-IP) studies using gentle detergent solubilization (digitonin or CHAPS rather than stronger detergents) can preserve physiologically relevant interactions. Validation of interactions should employ reciprocal Co-IP with multiple epitope tags to minimize tag-specific artifacts.

Genetic interaction mapping through synthetic lethality or synthetic sickness screens can identify functional relationships even when physical interactions are absent or transient. Construction of a double-knockout library targeting membrane proteins combined with high-throughput phenotypic assays can reveal functional networks.

Results should be analyzed within the context of membrane microdomains and protein clustering. CrcB homolog 2 may participate in functional complexes with:

  • Other ion transporters forming ion homeostasis networks

  • Cell envelope stress response proteins

  • Virulence-associated outer membrane proteins

  • Lipopolysaccharide biosynthesis machinery

Research has shown that the Brucella envelope plays a critical role in host-pathogen interactions. Studies indicate that Brucella infection triggers production of CXCR2 ligands like CXCL1 and CXCL2, which recruit neutrophils to infection sites . Understanding how CrcB homolog 2 interfaces with other envelope components that modulate these host responses could provide insights into virulence mechanisms and potential therapeutic targets.

What strategies address low expression yields of recombinant CrcB homolog 2?

Low expression yields of recombinant CrcB homolog 2 represent a common challenge that can be systematically addressed through multiple optimization strategies:

Expression system selection significantly impacts membrane protein yields. While E. coli remains the first-choice system, consider these alternatives for CrcB homolog 2:

Expression SystemAdvantagesConsiderations for CrcB homolog 2
E. coli C41(DE3)/C43(DE3)Specifically evolved for membrane proteinsStart with these strains before moving to alternatives
E. coli Lemo21(DE3)Tunable expression via rhamnose inductionEffective for toxic membrane proteins
Insect cells (Sf9, Hi5)Superior folding for complex proteinsRequires baculovirus system optimization
Cell-free systemsAllows direct addition of detergents/lipidsHigher cost but rapid optimization

Genetic optimization approaches include:

  • Codon optimization specific to expression host

  • Fusion partners (MBP, SUMO, Mistic) to enhance solubility

  • Signal sequence optimization for membrane targeting

  • Truncation constructs removing flexible regions while maintaining core function

Culture condition optimization should systematically evaluate:

  • Induction temperature (typically lowering to 16-20°C improves folding)

  • Inducer concentration (often 0.1-0.2 mM IPTG outperforms standard 1 mM)

  • Media formulation (defined media often superior to complex media)

  • Additives like glycine betaine (1 mM) and sorbitol (0.5 M) that stabilize membrane proteins

Solubilization screening is critical for extraction and purification:

  • Begin with milder detergents (DDM, LMNG) before trying harsher options

  • Consider native nanodiscs or SMALPs for detergent-free extraction

  • Implement high-throughput detergent screening using fluorescence-detection size exclusion chromatography (FSEC)

For diagnostic assessment of expression issues, implement a dual-reporter system with C-terminal GFP to monitor folding and an N-terminal tag to assess translation efficiency. This approach can rapidly identify whether challenges occur at translation, membrane insertion, or folding stages.

How can researchers resolve data inconsistencies between in vitro and in vivo studies of CrcB homolog 2 function?

Resolving discrepancies between in vitro and in vivo findings regarding CrcB homolog 2 function requires systematic analysis of potential contributing factors:

Environmental differences between laboratory and host conditions significantly impact protein function. Consider:

  • pH variations (test function across pH 4.5-7.5 range relevant to different intracellular compartments)

  • Ion composition differences (particularly Na+, K+, Ca2+, and Mg2+ concentrations)

  • Redox environment (oxidizing extracellular vs. reducing intracellular conditions)

  • Membrane composition (cholesterol content, phospholipid species profiles)

Protein interaction networks present in vivo may be absent in simplified in vitro systems:

  • Implement reconstitution studies with increasing complexity (pure protein → proteoliposomes with multiple components → extracted membrane fractions)

  • Identify potential regulatory partners through pull-down experiments from infected cells

  • Consider post-translational modifications present in vivo but absent in recombinant systems

Methodological considerations that may contribute to discrepancies:

  • Detection sensitivity limitations (particularly for low-abundance events)

  • Time-scale differences between rapid in vitro measurements and longer in vivo processes

  • Compensatory mechanisms in vivo that mask phenotypes evident in vitro

Bridging approaches to reconcile differences:

  • Ex vivo systems using extracted cellular components under controlled conditions

  • Cellular spheroplast patch-clamp for direct ion transport measurements

  • Genetic complementation studies with mutants expressing variants with defined in vitro properties

When investigating functional discrepancies, consider that CrcB homolog 2 operates within the context of complex host-pathogen interactions. Studies have shown that Brucella infection triggers inflammatory responses involving CXCR2-dependent neutrophil recruitment . The intersection between ion homeostasis functions and inflammatory signaling might explain some apparent discrepancies between isolated protein studies and in vivo observations.

What quality control metrics should be used to validate recombinant CrcB homolog 2 prior to functional studies?

Comprehensive quality control for recombinant CrcB homolog 2 is essential before proceeding to functional studies. A systematic validation pipeline should include:

Purity assessment using multiple orthogonal techniques:

  • SDS-PAGE with both Coomassie and silver staining (target >95% purity)

  • Size exclusion chromatography with multi-angle light scattering (SEC-MALS) to confirm monodispersity and oligomeric state

  • Mass spectrometry to verify protein identity and detect post-translational modifications or proteolytic damage

Structural integrity validation:

  • Circular dichroism (CD) spectroscopy to confirm secondary structure content

  • Fluorescence spectroscopy to assess tertiary structure through intrinsic tryptophan fluorescence

  • Thermal shift assays to determine protein stability and identify stabilizing conditions

  • Limited proteolysis to verify proper folding (properly folded proteins show discrete digestion patterns)

Functional activity verification:

  • Liposome-based fluoride transport assays using fluoride-sensitive fluorophores

  • Patch-clamp electrophysiology if reconstituted in planar lipid bilayers

  • Binding assays for known interacting partners

Homogeneity analysis:

  • Analytical ultracentrifugation to assess oligomeric state distribution

  • Negative-stain electron microscopy to visualize protein particles

  • Dynamic light scattering to detect aggregation

A standardized quality control report should include quantitative metrics for each parameter:

Quality ParameterAcceptable RangeMethodExample Results
Purity>95%SDS-PAGE densitometry97.3%
MonodispersityPDI < 0.2DLSPDI = 0.12
Identity>95% coverageLC-MS/MS98% coverage, no unexpected modifications
Secondary StructureConsistent with homology modelCircular Dichroism45% α-helix, 25% β-sheet
Thermal StabilityTm > 40°CDSFTm = 52.3°C
Activity>80% of positive controlFluoride transport assay87% of control activity

Batch-to-batch consistency should be rigorously maintained, with reference standards established from well-characterized preparations. Each new preparation should be compared to these standards before proceeding to experimental applications.

Additional quality controls specific to membrane proteins include detergent content analysis (by quantitative thin-layer chromatography) and lipid composition analysis if reconstituted in lipid bilayers or nanodiscs. These parameters can significantly impact functional measurements in subsequent experiments.

How might CrcB homolog 2 be leveraged for development of novel diagnostics for brucellosis?

Leveraging CrcB homolog 2 for novel brucellosis diagnostics presents several promising avenues based on its unique characteristics as a membrane protein with species specificity:

Serological detection approaches could utilize purified recombinant CrcB homolog 2 for antibody capture in ELISA formats. Key considerations include:

  • Epitope mapping to identify Brucella-specific regions distinct from commensal bacteria

  • Evaluation of sensitivity/specificity across different patient populations and disease stages

  • Comparison with established serological tests such as Rose Bengal and complement fixation tests

Molecular detection strategies might target the crcB2 gene as a PCR amplification target. Advantages include:

  • Potential for multiplex PCR with other Brucella-specific targets for increased specificity

  • Development of isothermal amplification methods (LAMP, RPA) for field-deployable diagnostics

  • Design of species-specific probes that distinguish Brucella melitensis from other Brucella species

Point-of-care testing platforms could incorporate CrcB homolog 2-based detection:

  • Lateral flow immunoassays using gold nanoparticle-conjugated anti-CrcB homolog 2 antibodies

  • Electrochemical biosensors employing aptamers selected against CrcB homolog 2

  • Microfluidic systems integrating sample preparation and detection

Comparative diagnostic performance should be assessed against gold standard methods:

Diagnostic ApproachSensitivitySpecificityAdvantagesLimitations
CrcB2 ELISA85-95% (estimated)90-98% (estimated)High-throughput, quantitativeRequires laboratory infrastructure
CrcB2 PCR90-98% (estimated)>99% (estimated)Highly specific, early detectionRequires sample processing, thermal cycling
CrcB2 Lateral Flow80-90% (estimated)85-95% (estimated)Rapid, field-deployableLower sensitivity than laboratory methods
Standard Culture50-80%>99%Definitive diagnosisTime-consuming (3-4 days) , biosafety concerns

Research has demonstrated that current diagnostic approaches for brucellosis include molecular techniques and traditional methods like culture, with bacterial colonies visible after 3-4 days of incubation . Innovative diagnostics targeting CrcB homolog 2 could potentially improve detection sensitivity or reduce the time to diagnosis.

What computational approaches best predict CrcB homolog 2 inhibitors as potential antimicrobial agents?

Computational discovery of CrcB homolog 2 inhibitors as novel antimicrobials requires integrated approaches spanning multiple scales:

Structure-based virtual screening provides a direct path to inhibitor discovery if structural data is available:

  • Homology modeling based on related CrcB proteins provides a starting template

  • Molecular dynamics simulations refine models, particularly for channel dynamics

  • Ensemble docking against multiple conformational states increases discovery probability

  • Fragment-based approaches may identify building blocks for larger inhibitors

Ligand-based approaches can proceed even without detailed structural data:

  • Pharmacophore modeling based on known fluoride channel inhibitors

  • Quantitative structure-activity relationship (QSAR) models if preliminary activity data exists

  • Similarity searching based on compounds that affect fluoride transport

Machine learning integration enhances traditional computational approaches:

  • Deep neural networks can identify non-obvious patterns in molecule-protein interactions

  • Reinforcement learning approaches like molecule generation models can design novel scaffolds

  • Transfer learning from related ion channel inhibitor datasets accelerates model development

Physicochemical considerations specific to membrane protein inhibitors:

  • Calculate logP and membrane partitioning to ensure compounds access the target

  • Consider compound aggregation potential which can cause false positives

  • Assess PAINS (pan-assay interference compounds) features early to eliminate problematic chemotypes

A strategic screening cascade might involve:

  • Initial high-throughput virtual screening (hundreds of thousands of compounds)

  • Secondary pharmacophore filtering and ADMET property prediction

  • Molecular dynamics simulations of top 100-500 candidates to assess binding stability

  • Quantum mechanical calculations for precise binding energy estimation of top candidates

  • Experimental validation of 10-50 diverse compounds representing different chemical scaffolds

The most promising candidates would then proceed to experimental testing in ion transport assays, followed by evaluations of antimicrobial activity and specificity. This computational workflow should integrate information from physiological contexts, such as the inflammatory environment during Brucella infection, which research has shown involves pathways regulated by receptors like CXCR2 .

How could CRISPR-Cas9 gene editing be applied to investigate CrcB homolog 2 function in Brucella melitensis?

CRISPR-Cas9 technology offers unprecedented precision for investigating CrcB homolog 2 function in Brucella melitensis, enabling sophisticated genetic manipulations beyond traditional methods:

Gene knockout strategies using CRISPR-Cas9 provide several advantages:

  • Higher efficiency compared to traditional homologous recombination

  • Reduced polar effects on adjacent genes compared to insertion-based inactivation

  • Capability for clean deletions without antibiotic resistance markers

  • Potential for multiplexed knockouts to address functional redundancy

Point mutation generation allows structure-function analysis:

  • Introduction of single nucleotide changes to alter specific amino acids

  • Creation of fluoride binding site mutations to directly test transport function

  • Generation of dominant-negative variants for mechanistic studies

  • Silent mutations for complementation controls

CRISPRi approaches for conditional knockdown:

  • dCas9-based repression for essential genes where knockout is lethal

  • Tunable expression using inducible promoters controlling dCas9

  • Tissue-specific or temporal regulation during infection studies

  • Gradual titration of expression levels to identify functional thresholds

CRISPR screening applications:

  • Pooled sgRNA libraries targeting genomic regions to identify genetic interactions

  • Saturating mutagenesis of the crcB2 locus to map functional domains

  • CRISPRa (activation) screens to identify compensatory pathways

Practical implementation considerations:

  • Optimization of sgRNA design for the high GC content of Brucella genomes

  • Development of efficient delivery systems (electroporation protocols, conjugation methods)

  • Selection of appropriate Cas9 variants (SpCas9, SaCas9, CjCas9) based on PAM compatibility

  • Temperature optimization (30-37°C) for optimal Cas9 activity without stress induction

A comprehensive CRISPR toolkit should include:

  • Series of targeting vectors with different promoters for flexible expression

  • Suite of validated sgRNAs targeting different regions of crcB2

  • Panel of engineered Cas9 variants optimized for Brucella biology

  • Collection of reporter systems to monitor editing efficiency

When applying these tools, researchers should consider the complex context of Brucella pathogenesis. Studies have shown that Brucella infections trigger inflammatory responses mediated by pathways including CXCR2 signaling . CRISPR-engineered strains with modifications to crcB2 could be evaluated for their impact on these host response pathways, providing insights into the intersection between bacterial ion homeostasis and host inflammatory signaling.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.