Recombinant Brucella melitensis biotype 1 Protein CrcB homolog 4 (crcB4)

Shipped with Ice Packs
In Stock

Description

Introduction to Brucella melitensis and CrcB Proteins

Brucella melitensis is the etiological agent of brucellosis, a zoonotic infectious disease that causes abortion in animals and chronic debilitating illness in humans. This pathogen enters the human host primarily through an incompletely defined mechanism of adhesion to and penetration of mucosal epithelium . B. melitensis has been classified into different biotypes, with biotype 1 and biotype 3 being the most commonly isolated strains from clinical specimens. Studies have shown that out of 41 Brucella strains isolated from blood and cerebrospinal fluid cultures, 2 strains were identified as B. melitensis biotype-1 and 39 strains as B. melitensis biotype-3 .

CrcB proteins constitute a family of membrane proteins found across various bacterial species, including Brucella. These proteins are generally characterized as putative fluoride ion transporters that help maintain ion homeostasis within bacterial cells. In Brucella melitensis biotype 1, several CrcB homologs have been identified, including CrcB homolog 3 (crcB3), which has been characterized as a putative fluoride ion transporter . While direct research on CrcB homolog 4 is limited in the provided literature, its function can be inferred from studies on related homologs within the same family.

Genetic Analysis and Expression Patterns

The gene encoding CrcB homolog 4 in Brucella melitensis biotype 1 likely shares regulatory elements with other CrcB homologs. Based on genome-wide expression studies of B. melitensis, many virulence-associated genes show growth phase-dependent expression patterns . While specific data on CrcB homolog 4 expression is not directly available in the provided literature, general patterns observed in B. melitensis suggest that genes involved in membrane functions and ion transport may be differentially expressed during various growth phases.

Research has demonstrated that B. melitensis cultures in the late-log phase of growth are more invasive in non-professional phagocytic cells than cultures at mid-log and stationary growth phases . This growth phase-dependent virulence may correlate with the expression of membrane proteins, potentially including CrcB homologs.

Functional Properties and Biological Role

CrcB proteins are generally identified as putative fluoride ion transporters, with CrcB homolog 3 in B. melitensis specifically annotated as such . By extension, CrcB homolog 4 likely serves a similar function, contributing to ion homeostasis within the bacterial cell.

The importance of ion homeostasis for bacterial survival cannot be overstated, particularly in the hostile environment of host tissues where various ions may reach toxic concentrations. Fluoride ion transport, in particular, is crucial for protecting bacterial cells from fluoride toxicity, which can inhibit enolase and other essential metabolic enzymes.

In the context of B. melitensis pathogenesis, membrane proteins play vital roles in host-pathogen interactions. While the outer membrane protein (Omp31) has been well-studied for its role in immunogenicity and protective efficacy against B. melitensis infection , the specific contributions of CrcB homologs to virulence remain to be fully elucidated.

Recombinant Production and Purification

The production of recombinant CrcB homolog proteins typically involves expression in E. coli systems with appropriate tags for purification. Based on the methodologies used for CrcB homolog 3, recombinant CrcB homolog 4 would likely be produced with an N-terminal His-tag to facilitate purification .

Table 1: Typical Specifications for Recombinant CrcB Homolog Proteins

ParameterSpecification
Expression SystemE. coli
Fusion TagN-terminal His-tag
FormLyophilized powder
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Storage Conditions-20°C/-80°C, avoid freeze-thaw cycles
ReconstitutionDeionized sterile water (0.1-1.0 mg/mL)
Recommended Addition5-50% glycerol for long-term storage

Proper handling of the recombinant protein is essential for maintaining its stability and activity. As with CrcB homolog 3, repeated freezing and thawing should be avoided, and working aliquots should be stored at 4°C for up to one week .

Applications in Research and Diagnostics

Recombinant proteins from B. melitensis have shown significant potential in vaccine development and diagnostic applications. For instance, the recombinant 31-kDa outer membrane protein (rOmp31) has demonstrated immunogenicity and protective efficacy against B. melitensis infection in mice .

By analogy, recombinant CrcB homolog 4 could potentially be evaluated for:

  1. Immunogenicity studies to determine its potential as a vaccine component

  2. Development of diagnostic assays for the detection of B. melitensis infections

  3. Structure-function studies to understand the mechanism of fluoride ion transport

  4. Drug development targeting ion transport mechanisms in Brucella

The potential of CrcB homolog proteins as therapeutic targets is particularly interesting given the antimicrobial resistance patterns observed in B. melitensis. Studies have shown varying susceptibilities of B. melitensis to different antibiotics, with doxycycline being the most active agent (MIC90 0.064 μg/ml), followed by ciprofloxacin (MIC90 0.25 μg/ml) . Understanding the role of ion transporters like CrcB homolog 4 could potentially lead to novel therapeutic approaches.

Future Research Directions

Several important knowledge gaps remain in our understanding of CrcB homolog 4:

  1. Determination of the complete amino acid sequence and three-dimensional structure

  2. Characterization of its specific ion transport properties and kinetics

  3. Assessment of its role in antimicrobial resistance and virulence

  4. Evaluation of its potential as a vaccine component or diagnostic marker

Advanced techniques such as cryo-electron microscopy, electrophysiology, and animal infection models would be valuable for addressing these knowledge gaps. Additionally, CRISPR-Cas9 gene editing approaches could be employed to generate CrcB homolog 4 knockout strains to evaluate its role in B. melitensis physiology and pathogenesis.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will prepare the product according to your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
crcB4; BMEII0470; Putative fluoride ion transporter CrcB 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)
Target Names
crcB4
Target Protein Sequence
MRFFLSGYVGRRIGETFPWGTFVVNVSGAFVIGTAAGLGARLGGIFSTTIFHEFIMVGLL GGYTTVSSFCLQSVNLMLDGEQRQALFNIVASALLCVLAVAAGYGGIMWIMEWPG
Uniprot No.

Target Background

Function
CrcB4 plays a crucial role in reducing fluoride concentration within the cell, thereby mitigating its toxicity.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Brucella melitensis biotype 1 Protein CrcB homolog 4 (crcB4)?

Recombinant Brucella melitensis biotype 1 Protein CrcB homolog 4 (crcB4) is a partial protein encoded in the B. melitensis genome, likely within a cluster of genes associated with pathogenesis or stress response mechanisms. It belongs to the CrcB protein family, which consists of small proteins (approximately 12-15 kDa) characterized by hydrophilic regions and conserved motifs involved in host-pathogen interactions. The recombinant form is typically produced through heterologous expression systems for research applications, allowing detailed investigation of its structural and functional properties independent of the native organism.

What are the best methods for obtaining purified recombinant crcB4 for research?

For obtaining purified recombinant crcB4, researchers should implement a systematic expression and purification protocol. Based on approaches used with related CrcB proteins, a recommended methodology includes:

  • Gene synthesis or PCR amplification of the crcB4 coding sequence from B. melitensis genomic DNA

  • Cloning into a T7-based expression vector with an appropriate affinity tag (typically His6)

  • Expression in E. coli BL21(DE3) or similar strains optimized for recombinant protein production

  • Induction of protein expression at 30°C with 0.5-1.0 mM IPTG for 4-6 hours

  • Cell lysis via sonication in a buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole

  • Purification using nickel-affinity chromatography followed by size-exclusion chromatography

  • Quality assessment via SDS-PAGE and Western blotting

This approach typically yields 2-5 mg of purified protein per liter of bacterial culture. For structural studies, additional optimization may be necessary to enhance protein stability and reduce aggregation.

How can researchers design experiments to study crcB4's role in B. melitensis pathogenesis?

To investigate crcB4's role in B. melitensis pathogenesis, researchers should implement a multi-faceted experimental approach:

  • Gene knockout/knockdown studies: Generate crcB4 deletion mutants using homologous recombination or CRISPR-Cas9 approaches, followed by comparative virulence assessment in cellular and animal models. This would reveal phenotypic changes associated with crcB4 absence.

  • Complementation assays: Reintroduce the crcB4 gene into knockout strains to confirm specificity of observed phenotypes, ideally using controlled expression systems.

  • Infection models: Employ both professional phagocytes (macrophages) and non-phagocytic cells to assess intracellular survival and replication kinetics, similar to virB operon studies which demonstrated expression beginning at 15 minutes post-infection .

  • Transcriptional profiling: Analyze expression patterns of crcB4 during different infection stages using RT-PCR or RNA-seq, which would reveal temporal regulation patterns similar to those observed with flagellar genes and virulence factors in B. melitensis .

  • Host response assessment: Evaluate immunological responses to recombinant crcB4, including potential delayed-type hypersensitivity reactions observed with related proteins.

Integration of these approaches would provide comprehensive insights into crcB4's functional significance in pathogenesis, particularly when compared with the well-characterized virB secretion system that is essential for B. melitensis intracellular survival and multiplication .

What are the appropriate controls when studying recombinant crcB4 protein function?

When studying recombinant crcB4 protein function, implementing rigorous controls is essential for experimental validity. Researchers should include:

  • Negative protein controls:

    • Purified irrelevant protein with similar molecular weight and properties

    • Heat-denatured crcB4 to distinguish activity from non-specific effects

    • Empty vector expression product to control for host cell contaminants

  • Positive protein controls:

    • Related CrcB homologs with characterized functions (e.g., crcB1)

    • Known B. melitensis virulence factors that have established phenotypes

  • Experimental controls:

    • Wild-type B. melitensis strain alongside any mutant strains

    • B. melitensis virB mutants as reference for intracellular behavior comparisons, since virB expression is essential for survival in phagocytic and non-phagocytic cells

    • Dose-response relationships to establish specificity

  • Technical controls:

    • Multiple biological replicates (minimum n=3)

    • Appropriate statistical analyses to handle experimental variability

    • Verification of protein folding and structure through circular dichroism or thermal shift assays

These controls help distinguish specific crcB4-mediated effects from artifacts and enable meaningful interpretation of results within the broader context of B. melitensis pathogenesis mechanisms.

How can researchers effectively address contradictions in experimental data regarding crcB4 function?

Addressing contradictions in experimental data regarding crcB4 function requires a structured analytical approach. Researchers should:

  • Document contradictory findings systematically: Catalog inconsistencies using a structured notation format that defines the number of interdependent items (α), the number of contradictory dependencies (β), and the minimal number of Boolean rules needed to assess these contradictions (θ) . For example, if contradictory results emerge from different host cell infection models, these should be classified and analyzed as distinct contradiction patterns.

  • Evaluate methodological differences: Conduct a comparative analysis of experimental protocols, focusing on:

    • Protein preparation methods and purity assessment

    • Cell type and culture conditions

    • Infection parameters (MOI, time points, media composition)

    • Detection methods and sensitivity thresholds

  • Implement cross-validation approaches: Verify contradictory findings using alternative experimental techniques. For instance, if protein-protein interaction results differ between yeast two-hybrid and co-immunoprecipitation studies, employ surface plasmon resonance or proximity ligation assays as third-party validation.

  • Consider biological variability: Analyze whether contradictions reflect true biological phenomena rather than technical artifacts. B. melitensis shows differential expression of virulence genes during different infection stages, suggesting that crcB4 function may similarly vary with microenvironmental conditions .

  • Apply Boolean minimization techniques: When multiple contradictory observations exist, apply Boolean logic to identify the minimal set of rules that explain the observed contradictions . This approach can reveal whether apparent contradictions stem from a smaller set of fundamental incompatibilities.

This structured approach transforms contradictions from obstacles into valuable indicators that may reveal the contextual nature of crcB4 function in different experimental systems.

What structural biology approaches are most suitable for characterizing crcB4?

For comprehensive structural characterization of crcB4, researchers should employ a complementary multi-technique approach:

  • X-ray crystallography: Offers high-resolution structural information but requires:

    • Optimization of recombinant crcB4 expression with minimal flexible regions

    • Systematic screening of crystallization conditions (pH, salt, precipitants)

    • Addition of potential binding partners to stabilize conformational states

    • Resolution refinement to at least 2.5Å for reliable structural determination

  • Cryo-electron microscopy (Cryo-EM): Valuable for visualizing crcB4 in different functional states:

    • Single-particle analysis for conformational heterogeneity assessment

    • Potential visualization of larger complexes involving crcB4 and interaction partners

    • Implementation of novel contrast enhancement techniques for this small protein (14 kDa)

  • NMR spectroscopy: Ideal for characterizing dynamic features:

    • Isotopic labeling (13C, 15N) of recombinant crcB4 for multidimensional NMR

    • Analysis of conformational changes upon interaction with host factors

    • Identification of flexible regions that may mediate protein-protein interactions

  • Computational structural biology:

    • Homology modeling based on the 40% sequence identity with crcB1

    • Molecular dynamics simulations to predict conformational changes during host interaction

    • Integration with experimental data through hybrid modeling approaches

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Mapping of solvent-accessible regions to identify potential interaction surfaces

    • Tracking conformational changes under different physiological conditions

The integration of these approaches would provide comprehensive insights into crcB4's structure-function relationships, potentially revealing mechanistic details of its role in B. melitensis pathogenesis.

How can CDR engineering approaches be adapted for studying crcB4-host interactions?

Complementarity-determining region (CDR) engineering approaches, similar to those used in CXCR4 receptor studies, offer innovative strategies for investigating crcB4-host interactions. These can be implemented as follows:

  • Generation of crcB4-specific antibodies with elongated CDRs:

    • Design antibodies with extended CDRH3 regions that can access potential binding pockets in crcB4, similar to the β-hairpin conformation peptides used in CXCR4 targeting

    • Engineer CDRH2 regions as alternatives for improved solvent accessibility and binding, which could be particularly valuable if crcB4 has buried interaction domains

    • Develop dual-function antibodies by grafting different interaction peptides into distinct CDRs, enabling simultaneous targeting of multiple crcB4 epitopes

  • Functional screening assays:

    • Implement Tag-lite homogeneous time-resolved fluorescence (HTRF) assays to quantitatively determine binding affinities between engineered antibodies and crcB4

    • Develop competition assays to identify critical host interaction partners

    • Establish cellular readouts like calcium flux measurements to assess functional consequences of binding

  • Epitope mapping and interaction analysis:

    • Use engineered antibodies as probes to identify key functional domains in crcB4

    • Compare binding parameters across different engineered constructs to establish structure-activity relationships

    • Develop CDR variants with progressively modified structures to perform alanine-scanning mutagenesis at the antibody level

  • Therapeutic potential assessment:

    • Evaluate whether engineered antibodies can neutralize crcB4-mediated virulence mechanisms

    • Test ability to block intracellular replication similar to virB-dependent pathways

    • Assess potential for diagnostic applications similar to other Brucella proteins

This approach leverages advanced antibody engineering techniques to develop molecular tools that can precisely interrogate crcB4's interaction landscape and potentially disrupt pathogenesis mechanisms.

What bioinformatics pipelines are recommended for analyzing crcB4 homology across Brucella species?

For comprehensive analysis of crcB4 homology across Brucella species, researchers should implement a systematic bioinformatics pipeline incorporating:

  • Sequence retrieval and curation:

    • Extract CrcB homolog sequences from genome databases (NCBI, UniProt, KEGG)

    • Verify annotation quality and completeness

    • Include reference to KEGG: bme:BMEII0470 and STRING: 224914.BAWG_2097 identifiers

  • Multiple sequence alignment optimization:

    • Implement progressive alignment tools (MUSCLE, MAFFT) with iterative refinement

    • Apply sequence-specific gap penalties considering protein secondary structure prediction

    • Perform manual curation of alignments to correct for annotation errors

  • Phylogenetic analysis:

    • Construct maximum likelihood trees using appropriate evolutionary models

    • Implement Bayesian methods for confidence assessment

    • Correlate evolutionary patterns with host specificity and virulence profiles

  • Structural homology modeling:

    • Generate comparative models based on closest homologs with resolved structures

    • Validate models using energy minimization and Ramachandran plot analysis

    • Map sequence conservation onto structural models to identify functional motifs

  • Functional domain prediction:

    • Identify conserved motifs across the CrcB family

    • Predict protein-protein interaction sites based on surface conservation

    • Compare with experimental data from related proteins like crcB1

  • Comparative genomic context analysis:

    • Analyze gene neighborhood conservation across species

    • Identify potential operonic structures and co-regulated genes

    • Correlate with transcriptional data similar to studies on virB operon expression

This integrated approach will provide insights not only into sequence relationships but also functional implications of observed conservation patterns, potentially revealing species-specific adaptations in crcB4 function.

How should researchers design experiments to resolve contradictions in crcB4 function across different experimental systems?

To systematically resolve contradictions in crcB4 function across different experimental systems, researchers should implement a structured experimental design that addresses potential sources of variability:

  • Standardization protocol development:

    • Establish a reference preparation of recombinant crcB4 with defined purity and activity metrics

    • Implement consistent expression and purification methods across laboratories

    • Develop standard operating procedures for key assays with defined quality control parameters

  • Factorial experimental design:

    • Identify key variables that might influence experimental outcomes (e.g., cell types, infection conditions, bacterial growth phase)

    • Design experiments that systematically vary these factors to identify interaction effects

    • Apply statistical design principles to minimize required experiment numbers while maximizing information gain

  • Multi-laboratory validation approach:

    • Coordinate parallel experiments across independent laboratories using standardized protocols

    • Implement blinded analysis of results to reduce confirmation bias

    • Establish quantitative metrics for assessing inter-laboratory reproducibility

  • Systematic contradiction analysis:

    • Apply the (α, β, θ) notation system to classify contradictions based on the number of interdependent factors involved

    • Determine whether contradictions reflect genuine biological complexity rather than methodological inconsistencies

    • Identify minimal sets of Boolean rules that can explain observed contradictory patterns

  • Integration with systems biology approaches:

    • Place crcB4 function within broader pathways of B. melitensis pathogenesis

    • Analyze potential contextual dependencies similar to those observed with virB expression, which is regulated by factors including intracellular acidification and bacterial density

    • Develop predictive models that incorporate conditional dependencies

This approach transforms apparent contradictions into informative insights about the context-specific nature of crcB4 function, similar to how understanding of virB regulation evolved from seemingly contradictory observations about its expression patterns during infection .

What are the most promising approaches for investigating crcB4's potential role in immune modulation?

Investigating crcB4's potential role in immune modulation presents several promising research avenues:

  • Macrophage interaction studies:

    • Examine crcB4's impact on phagosome maturation and intracellular trafficking pathways

    • Compare with established virB-dependent mechanisms that allow Brucella to establish replicative niches

    • Assess effects on macrophage polarization (M1/M2 balance) during infection

  • Cytokine profiling and signaling pathway analysis:

    • Implement comprehensive cytokine/chemokine arrays to identify crcB4-specific immune signatures

    • Examine MAPK1 pathway interactions, which have been confirmed as critical for B. melitensis intracellular survival

    • Investigate potential interference with pattern recognition receptor signaling

  • Antigen presentation modulation:

    • Evaluate crcB4's effects on MHC class I and II expression and loading

    • Analyze impacts on dendritic cell maturation and cross-presentation

    • Assess potential for delayed-type hypersensitivity responses similar to those observed with related proteins

  • Lymphocyte response characterization:

    • Examine T cell activation and polarization in response to crcB4

    • Analyze B cell antibody production profiles and epitope targeting

    • Investigate memory immune response development and durability

  • Novel interaction partner identification:

    • Implement proximity labeling techniques (BioID, APEX) to identify host targets

    • Perform co-immunoprecipitation studies with subsequent mass spectrometry

    • Validate interactions using complementary approaches like fluorescence resonance energy transfer

  • In vivo immune modulation assessment:

    • Develop crcB4 knockout and complemented strains for animal infection models

    • Evaluate organ-specific immune responses, particularly in Peyer's patches where B. melitensis has been isolated as early as 15 minutes post-infection

    • Analyze chronicity and persistence mechanisms potentially mediated by crcB4

These approaches would collectively provide insight into whether crcB4 contributes to the sophisticated immune evasion strategies employed by B. melitensis during establishing persistent infection.

How can transcriptional profiling enhance our understanding of crcB4 regulation during infection?

Transcriptional profiling offers powerful insights into crcB4 regulation during infection when implemented through a comprehensive strategy:

  • Temporal expression analysis:

    • Perform high-resolution time-course RNA sequencing during infection stages (15 min to 72 hours post-infection)

    • Compare with established expression patterns of virB operon, which initiates expression at 15 minutes post-infection and reaches maximum levels at 5 hours

    • Correlate expression with different stages of intracellular trafficking and replication

  • Single-cell transcriptomics approach:

    • Implement scRNA-seq to characterize heterogeneity in crcB4 expression across bacterial populations

    • Determine whether expression correlates with specific bacterial subpopulations or metabolic states

    • Integrate with host cell transcriptional responses to identify potential regulatory cross-talk

  • Stress-response correlation studies:

    • Examine crcB4 expression under various stress conditions (oxidative, acidic, nutrient limitation)

    • Compare with other stress-responsive genes to identify co-regulation patterns

    • Investigate potential role in acid resistance similar to acidification-induced virB expression

  • Host-microenvironment impact assessment:

    • Analyze expression patterns across different host cell types (macrophages, dendritic cells, epithelial cells)

    • Examine tissue-specific regulation in animal models, focusing on sites like Peyer's patches where rapid invasion occurs

    • Identify host factors that influence crcB4 transcription

  • Regulatory network reconstruction:

    • Identify potential transcription factors and regulatory elements controlling crcB4 expression

    • Investigate quorum sensing systems similar to the homoserine lactone-mediated repression observed with virB

    • Develop predictive models of crcB4 regulation during different infection phases

  • Integration with proteomics and metabolomics:

    • Correlate transcriptional changes with protein abundance and modification states

    • Identify potential post-transcriptional regulatory mechanisms

    • Link metabolic state changes to crcB4 expression patterns

This multi-faceted approach would establish whether crcB4 expression follows similar patterns to other virulence factors like the virB operon, which shows dynamic regulation during intracellular infection stages , thereby revealing its potential role in the temporal orchestration of B. melitensis pathogenesis.

What are the critical knowledge gaps that should be prioritized in crcB4 research?

Based on current understanding of crcB4 and related proteins in B. melitensis, several critical knowledge gaps should be prioritized:

Addressing these knowledge gaps would transform crcB4 from a hypothetical protein of interest to a well-characterized component of B. melitensis pathogenicity mechanisms, potentially revealing new therapeutic or diagnostic opportunities.

How should researchers integrate crcB4 studies with broader investigations of B. melitensis pathogenesis mechanisms?

Effectively integrating crcB4 studies with broader investigations of B. melitensis pathogenesis requires a strategic approach that places this protein within its functional context:

  • Comparative virulence factor studies:

    • Analyze crcB4 alongside established virulence determinants like the virB secretion system

    • Implement parallel knockout studies to identify potential functional redundancy or synergy

    • Develop double/triple mutant strains to characterize interaction networks among virulence factors

  • Temporal integration approach:

    • Map crcB4 activity within the established timeline of B. melitensis infection, from initial invasion (occurring as early as 15 minutes in Peyer's patches) through intracellular replication

    • Determine whether crcB4 functions in early invasion, phagosome evasion, or persistent infection stages

    • Correlate with expression patterns of other virulence factors that show stage-specific regulation

  • Systems biology framework implementation:

    • Integrate transcriptomic, proteomic, and functional data into comprehensive pathogenesis models

    • Apply network analysis to identify functional clusters and regulatory hubs

    • Develop predictive models of pathogen-host interactions incorporating crcB4 functionality

  • Host response correlation:

    • Analyze host MAPK1 expression and other critical pathways in response to wild-type versus crcB4-mutant strains, building on established importance of these pathways

    • Characterize immune evasion mechanisms potentially mediated by crcB4

    • Identify potential diagnostic biomarkers based on host response patterns

  • Translational research integration:

    • Evaluate crcB4 as a potential diagnostic target or vaccine component

    • Assess conserved epitopes across Brucella species for broad-spectrum applications

    • Investigate structure-based drug design targeting crcB4 or its interaction partners

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.