Recombinant Brucella melitensis biotype 1 Putative peptide permease protein BMEII0860 (BMEII0860)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant protein is produced via heterologous expression in E. coli BL21(DE3) . Key production parameters include:

ParameterSpecification
Expression VectorpET-22b or pET-28a(+)
Induction AgentIPTG or lactose
Purification MethodAffinity chromatography (His tag)
Purity>85–90% (SDS-PAGE)
Yield7.2–9.4 mg/L (varies with host system)
StorageLyophilized powder at -20°C/-80°C; reconstituted in Tris/PBS buffer

Continuous fermentation methods have been explored to optimize yield, leveraging glycerol and lactose as carbon sources .

Immunological Relevance

BMEII0860 has been evaluated as a subunit vaccine candidate due to its antigenic properties:

  • Immune Response: In guinea pigs, recombinant BMEII0860 elicited IgG levels comparable to the commercial Rev.1 vaccine .

  • Cellular Immunity: High IL-2 and IFN-γ secretion indicates robust T-cell activation .

  • Epitope Mapping: Computational studies identified 19 T- and B-cell epitopes, suggesting its utility in multi-epitope vaccine designs .

Comparative Analysis with Other Brucella Proteins

ProteinFunctionExpression SystemImmune Response
BMEII0860Peptide permeaseE. coliHigh IgG, IL-2, IFN-γ
Omp10-Omp28-L7/L12Outer membrane protein fusionPichia pastorisModerate IgG
MEL polypeptideMulti-epitope antigenE. coliProliferative T-cells

BMEII0860 outperforms outer membrane proteins in inducing cellular immunity, critical for combating intracellular pathogens like Brucella .

Applications and Research Utility

  • Vaccine Development: Tested in preclinical models for brucellosis prophylaxis .

  • Diagnostic Tools: Used in ELISA kits to detect Brucella-specific antibodies .

  • Structural Studies: Analyzed for ABC transporter mechanisms and drug target potential .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have specific format requirements, please indicate them during order placement. We will fulfill your request based on availability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize the development of the specified tag.
Synonyms
BMEII0860; Putative peptide permease protein BMEII0860
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)
Target Names
BMEII0860
Target Protein Sequence
MLRYCLHRLLIGLGMLLALTILIFVLLQLTPGDPIDAYINPNVAMTQAEMDALRAQLGLD RPLPVQYLAWLGQAVQGNLGHSLQRFNETVSGLIASRIGPTLLLMAAGLAIAIVIGVTTG IISAVRRNSFPDYSFSVLALLGISSPAFLTALLGLYVFSVRLKWAPSGGMLTPATDFSIP DLLRHLALPALVLSIGHAALIMRYMRSSMLETLNQDYVRTARAKGVREFWVVVKHTLRNA MLPVVTLIGSTIGLAVGGAIFIESVFNWPGMGLLLINAVETRDYPVIMGATLVIGACVII VNILTDLAYAVIDPRIKVT
Uniprot No.

Target Background

Function
This protein likely plays a role in an ABC transporter complex involved in peptide import. It is likely responsible for translocating the substrate across the membrane.
Database Links
Protein Families
Binding-protein-dependent transport system permease family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is BMEII0860 and what is its general function?

BMEII0860 is a putative peptide permease protein from Brucella melitensis biotype 1. This protein consists of 319 amino acids and likely functions in the transport of peptides across the bacterial membrane . As a member of the peptide permease family, it's hypothesized to be involved in nutrient acquisition through the transport of small peptides into the bacterial cell. Based on homology with other peptide permeases, BMEII0860 likely contributes to bacterial survival by facilitating the uptake of essential nutrients, particularly in nutrient-limited environments such as those encountered during host infection.

What expression systems are most effective for producing recombinant BMEII0860 protein?

E. coli has been demonstrated as an effective expression system for recombinant BMEII0860 protein production . For optimal expression, consider using a bacterial expression vector with an inducible promoter system (such as T7 or lac) and including a histidine tag for simplified purification. When expressing BMEII0860 in E. coli:

  • Optimize codon usage for E. coli if expression levels are insufficient

  • Test different E. coli strains (BL21(DE3), Rosetta, etc.) to determine optimal expression

  • Vary induction conditions (temperature, IPTG concentration, induction time) to maximize yield

  • Consider solubility issues, as membrane-associated proteins may require detergent solubilization

For difficult-to-express constructs, alternative systems such as yeast or insect cell expression might be considered, although these would require additional optimization steps.

How can I confirm the identity and purity of recombinant BMEII0860 protein?

Confirmation of recombinant BMEII0860 identity and purity requires multiple analytical techniques:

  • SDS-PAGE analysis: Should show a single band at approximately 35-40 kDa (considering the additional His-tag)

  • Western blotting: Use anti-His antibodies to confirm presence of the tagged protein

  • Mass spectrometry: For definitive identification through peptide mass fingerprinting

  • Size exclusion chromatography: To assess protein homogeneity and detect aggregation

  • N-terminal sequencing: To confirm proper translation initiation

For functional validation, consider developing activity assays based on peptide transport if the appropriate substrates can be identified. Recombinant BMEII0860 should be purified to >95% homogeneity for most research applications, with verification of proper folding through circular dichroism or other structural analyses.

How does BMEII0860 expression change during different growth phases of B. melitensis, and how might this relate to virulence?

While specific BMEII0860 expression data across growth phases isn't directly reported in the literature, research on B. melitensis gene expression patterns suggests potential growth phase-dependent regulation. B. melitensis demonstrates different invasiveness levels at various growth stages, with late-log phase cultures showing higher invasiveness compared to stationary phase cultures .

Expression analysis should consider:

  • Quantitative RT-PCR targeting BMEII0860 transcript levels across growth phases

  • RNA-Seq analysis comparing transcriptomes across mid-log, late-log, and stationary phases

  • Western blotting to confirm if transcript changes translate to protein level alterations

Regulation may involve alternative sigma factors like sigma 32 (BMEI0280) that is upregulated in stationary phase or sigma 54 (rpoN, BMEI1789) that is upregulated in late-log phase compared to stationary phase . These transcription factors could potentially regulate BMEII0860 expression as part of a coordinated response to environmental conditions, potentially contributing to virulence mechanisms during host infection.

What methodologies are most effective for studying BMEII0860 expression during in vivo infection?

Studying BMEII0860 expression during in vivo infection presents significant challenges due to low bacterial numbers in host tissues. Based on recent methodological advances, the following approaches are recommended:

  • Coincidence cloning technique: This method has successfully recovered and characterized B. melitensis RNA from in vivo lymph node infections . This approach would be valuable for detecting BMEII0860 transcripts in naturally infected tissues.

  • RT-PCR targeting highly expressed genes: Research indicates that detection of bacterial RNA transcripts by RT-PCR can be more sensitive than detection of genomic DNA, due to higher copy numbers of RNA molecules . For BMEII0860, designing primers for RT-PCR could enable detection even at low bacterial loads.

  • RNA-Seq of infected tissues: Following enrichment of bacterial RNA from host tissues, RNA-Seq can provide comprehensive transcriptional profiles, allowing assessment of BMEII0860 in the context of the entire B. melitensis transcriptome.

  • In situ hybridization: For localization of BMEII0860 expression within infected tissues, in situ hybridization with labeled probes specific to BMEII0860 mRNA could be employed.

Each approach requires careful optimization and appropriate controls to distinguish bacterial transcripts from host background.

How might contradictory findings about BMEII0860 function be reconciled through context analysis?

When faced with contradictory findings regarding BMEII0860 function, context analysis methodology can help reconcile apparent discrepancies. Research on contradictions in biomedical literature indicates that many conflicts arise from underspecified contexts, including differences in species, temporal contexts, and environmental conditions .

For BMEII0860 functional analysis, consider evaluating the following contextual factors:

  • Experimental model differences: Results from cell culture systems may differ from in vivo infection models

  • Growth conditions: Nutrient availability, pH, temperature, and oxygen tension can affect protein function

  • Bacterial strain variations: Even within B. melitensis biotype 1, strain-specific genetic differences may exist

  • Temporal considerations: Expression and function may vary across infection timeline

  • Host species differences: Function may vary between different host organisms

To systematically address contradictions:

  • Create a structured database of claims about BMEII0860 function from literature

  • Annotate each claim with experimental conditions and contexts

  • Identify potentially conflicting claims and analyze contextual differences

  • Design experiments specifically to test hypotheses explaining the contradictions

This approach aligns with developing methods for contradiction detection in scientific literature and can lead to more nuanced understanding of BMEII0860's functional role.

What are the optimal conditions for detecting BMEII0860 in infected tissue samples?

Detecting BMEII0860 in infected tissue samples requires sensitive and specific methodologies due to the typically low abundance of B. melitensis in host tissues. Based on recent advances in pathogen detection, the following optimized protocol is recommended:

  • Sample preparation:

    • Process tissue samples immediately after collection to minimize RNA degradation

    • Use RNA preservation solutions (RNAlater or similar) if immediate processing isn't possible

    • Employ mechanical disruption followed by differential lysis to separate bacterial from host cells

  • RNA enrichment:

    • Apply host RNA depletion techniques to enrich for bacterial transcripts

    • Consider using coincidence cloning methodology, which has successfully recovered B. melitensis RNA from goat lymph nodes

  • Amplification strategy:

    • Design primers targeting BMEII0860 with high specificity, avoiding cross-reactivity with host sequences

    • Consider using nested PCR approaches for increased sensitivity

    • Implement RT-PCR targeting BMEII0860 transcripts rather than genomic DNA for improved sensitivity

  • Detection methods:

    • Quantitative RT-PCR with appropriate internal controls

    • Droplet digital PCR for absolute quantification at very low abundance

    • Consider RNA-Seq for comprehensive transcriptional profiling

  • Validation:

    • Include spike-in controls to establish detection limits

    • Use multiple primer sets targeting different regions of BMEII0860

    • Confirm positive results with orthogonal methods (e.g., immunohistochemistry)

The detection limit should be established for each tissue type, as host factors may differentially affect assay sensitivity.

What protein interaction studies would best elucidate BMEII0860's role in B. melitensis virulence?

To comprehensively characterize BMEII0860's protein interactions and potential role in virulence, a multi-faceted approach is recommended:

  • In vitro interaction studies:

    • Pull-down assays using His-tagged recombinant BMEII0860

    • Yeast two-hybrid screening against a B. melitensis library

    • Surface plasmon resonance to determine binding kinetics with candidate interactors

    • Cross-linking mass spectrometry to capture transient interactions

  • In vivo interaction studies:

    • Bacterial two-hybrid systems adapted for B. melitensis

    • Co-immunoprecipitation from bacterial lysates using anti-BMEII0860 antibodies

    • Proximity labeling approaches (BioID or APEX) in live bacteria

    • Fluorescence resonance energy transfer (FRET) for monitoring interactions in living cells

  • Functional validation:

    • Generate BMEII0860 knockout strains and assess virulence in cellular and animal models

    • Complement knockout strains with mutated versions to identify critical interaction domains

    • Competitive infection assays between wild-type and BMEII0860 mutants

    • Transcriptional profiling of wild-type vs. knockout strains to identify downstream effects

  • Structural studies:

    • X-ray crystallography or cryo-EM of BMEII0860 alone and in complex with interacting partners

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

    • In silico modeling and docking studies to predict interaction partners

These approaches should be integrated with virulence assays to correlate specific protein interactions with pathogenic mechanisms.

How can researchers design experiments to determine if BMEII0860 contributes to epithelial cell invasion?

Determining BMEII0860's potential role in epithelial cell invasion requires systematic experimental design:

  • Genetic manipulation approaches:

    • Generate a BMEII0860 knockout mutant in B. melitensis

    • Create complemented strains (wild-type BMEII0860 in knockout background)

    • Develop point mutants in key functional domains

    • Consider conditional expression systems for temporal control

  • In vitro invasion assays:

    • Standardized HeLa cell invasion assays with wild-type vs. mutant strains

    • Compare invasion at different MOIs (multiplicity of infection)

    • Assess invasion kinetics at multiple timepoints (30 min, 1h, 2h, etc.)

    • Use microscopy to track invasion process with fluorescently labeled bacteria

  • Mechanistic studies:

    • Gene expression analysis of wild-type vs. mutant during epithelial cell interaction

    • Examine if BMEII0860 expression changes at different bacterial growth phases

    • Localization studies to determine if BMEII0860 is surface-exposed during invasion

    • Biochemical analysis of potential peptide substrate transport during invasion

  • Controls and validation:

    • Include known invasion-deficient mutants as positive controls

    • Use multiple epithelial cell lines to ensure robustness

    • Validate in vivo using appropriate animal models

    • Compare with other characterized B. melitensis invasion factors

When designing these experiments, consider that B. melitensis exhibits different invasiveness depending on growth phase, with late-log phase cultures showing enhanced invasion of epithelial cells compared to stationary phase cultures . Therefore, standardizing the growth phase for invasion experiments is critical for reproducibility.

What statistical approaches are most appropriate for analyzing BMEII0860 expression data across different experimental conditions?

When analyzing BMEII0860 expression data across different experimental conditions, researchers should implement robust statistical approaches that account for the biological complexity and technical variability inherent in such experiments:

  • For RT-qPCR data:

    • Normalize using multiple, validated reference genes rather than a single housekeeping gene

    • Apply the ΔΔCt method with appropriate corrections for PCR efficiency

    • Use non-parametric tests (e.g., Mann-Whitney) for small sample comparisons

    • Implement ANOVA with post-hoc tests for multiple condition comparisons

  • For RNA-Seq data:

    • Normalize using methods appropriate for bacterial transcriptomes (e.g., DESeq2, edgeR)

    • Account for batch effects using techniques like ComBat or RUVSeq

    • Apply FDR correction for multiple testing (Benjamini-Hochberg procedure)

    • Consider time-course analysis methods for infection studies

  • For proteomics data:

    • Normalize using global or spike-in standards

    • Account for missing values appropriately (not at random vs. below detection)

    • Use specialized software for relative quantification from complex samples

    • Validate key findings with targeted methods (e.g., PRM or MRM)

  • For integrated analysis:

    • Apply multivariate methods such as principal component analysis or partial least squares

    • Consider network analysis to place BMEII0860 in broader biological context

    • Use longitudinal data analysis for time-dependent studies

    • Implement Bayesian approaches for integrating diverse data types

For all analyses, perform power calculations during experimental design to ensure adequate statistical power, typically aiming for 80% power at α=0.05, with appropriate sample sizes based on expected effect sizes from pilot studies.

How can researchers effectively compare BMEII0860 function across different Brucella species and strains?

To effectively compare BMEII0860 function across different Brucella species and strains, researchers should implement a systematic comparative approach:

  • Sequence and structural analysis:

    • Perform multiple sequence alignment of BMEII0860 homologs across Brucella species

    • Calculate conservation scores for each amino acid position

    • Identify species-specific variations in key functional domains

    • Construct phylogenetic trees to visualize evolutionary relationships

  • Standardized functional assays:

    • Develop consistent protocols for peptide transport assays applicable across species

    • Use identical growth conditions and media compositions

    • Employ matched genetic backgrounds when creating knockout mutants

    • Assess function in identical host cell systems

  • Heterologous expression studies:

    • Express BMEII0860 variants from different species in a common Brucella background

    • Create chimeric proteins to identify species-specific functional domains

    • Use controlled expression systems to ensure comparable protein levels

    • Quantify complementation efficiency in standardized assays

  • In vivo comparative studies:

    • Use identical infection routes and doses across species

    • Match bacterial growth phases at the time of infection

    • Employ the same host genetic background for animal models

    • Apply coincidence cloning or similar techniques for in vivo expression analysis

  • Data integration framework:

    • Create a standardized database of functional parameters across species

    • Develop scoring systems to quantify functional differences

    • Apply machine learning approaches to identify patterns in complex datasets

    • Correlate functional differences with host specificity or virulence patterns

This comparative approach will help identify conserved versus species-specific aspects of BMEII0860 function, potentially revealing adaptations to different host environments.

What emerging technologies could advance our understanding of BMEII0860's role in Brucella pathogenesis?

Several cutting-edge technologies offer promising avenues for elucidating BMEII0860's role in Brucella pathogenesis:

  • CRISPR-Cas9 genome editing:

    • Precise engineering of point mutations in BMEII0860 without polar effects

    • Creation of conditional knockdowns using CRISPRi

    • Implementation of CRISPR screens to identify genetic interactions

    • Development of base editing approaches for targeted amino acid substitutions

  • Single-cell technologies:

    • Single-cell RNA-Seq of infected host cells to capture heterogeneity in bacterial gene expression

    • Spatial transcriptomics to correlate BMEII0860 expression with tissue microenvironments

    • CyTOF analysis for high-dimensional phenotyping of infection

    • Single-cell bacterial tracking in host tissues with advanced microscopy

  • Advanced structural biology tools:

    • Cryo-electron tomography to visualize BMEII0860 in native membrane environment

    • Integrative structural biology combining crystallography, NMR, and computational modeling

    • Time-resolved structural studies to capture transport cycle intermediates

    • AlphaFold2 or similar AI approaches for structural prediction of complexes

  • Metabolomics approaches:

    • Targeted metabolite profiling to identify peptide substrates

    • Stable isotope labeling to track nutrient acquisition pathways

    • Untargeted metabolomics to discover novel transport functions

    • Integration of transcriptomics and metabolomics data for pathway analysis

  • Advanced in vivo imaging:

    • Intravital microscopy with fluorescently tagged BMEII0860

    • Bioluminescence imaging to track infection dynamics in real-time

    • PET imaging with radiolabeled tracers to monitor bacterial metabolism

    • Photoacoustic imaging for deeper tissue penetration

These emerging technologies, when strategically implemented, can provide unprecedented insights into BMEII0860's functional role during infection and potential as a therapeutic target.

How might BMEII0860 research contribute to development of new diagnostic or therapeutic approaches for brucellosis?

BMEII0860 research has significant potential to inform novel diagnostic and therapeutic strategies for brucellosis management:

  • Diagnostic applications:

    • Development of PCR-based assays targeting BMEII0860 sequences for sensitive detection

    • Creation of antibody-based tests detecting BMEII0860 protein in clinical samples

    • Integration into multiplex detection platforms for comprehensive pathogen profiling

    • Design of aptamer-based biosensors for rapid point-of-care testing

  • Therapeutic targeting strategies:

    • High-throughput screening for small molecule inhibitors of BMEII0860 transport function

    • Structure-based drug design targeting critical functional domains

    • Peptide-based competitive inhibitors mimicking natural substrates

    • Antibody-drug conjugates targeting BMEII0860 if surface-exposed

  • Vaccine development approaches:

    • Evaluation of BMEII0860 as a potential subunit vaccine component

    • Rational attenuation through BMEII0860 modification for live vaccine candidates

    • Assessment of protective immunity elicited by BMEII0860 immunization

    • Vectored vaccine strategies expressing modified BMEII0860

  • Host-directed therapies:

    • Modulation of host pathways interacting with BMEII0860

    • Enhancement of specific immune responses targeting BMEII0860-expressing bacteria

    • Combination therapies targeting both bacterial and host factors

    • Personalized approaches based on host genetic factors

Implementation of coincidence cloning and other advanced techniques for in vivo transcriptional analysis will be crucial for validating BMEII0860 as a viable target in actual infection settings, rather than just in vitro models.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.