Recombinant Brucella melitensis biotype 1 Putative peptide transport system permease protein BMEII0207/BMEII0208 (BMEII0207/BMEII0208)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Expression Systems
The protein is produced via recombinant expression, with optimization strategies to enhance solubility and yield:

  • Cell-Free Systems: Used for rapid production without host limitations .

  • Co-Expression with Chaperones: Trigger Factor (TF) or GroEL-GroES improves folding and reduces aggregation, particularly for hydrophobic proteins like permeases .

Purification Methods

  • SDS-PAGE: Used to confirm purity and integrity .

  • Ion-Exchange or Affinity Chromatography: Likely employed for final purification .

Yield and Cost

Product FormatQuantityPrice (USD)Source
Partial Recombinant Protein0.02 mg$1,775
Full-Length Recombinant Protein0.1 mg$12,830

Research Findings

Transcriptional Regulation in Infection
During early B. melitensis infection in bovine hosts, ABC transporters (including BMEII0207/BMEII0208) are transcriptionally repressed to avoid triggering host immune responses . This downregulation aligns with the pathogen’s stealth strategy to evade innate immunity.

Functional Studies

  • ABC Transporter Role: The protein likely collaborates with substrate-binding proteins (SBPs) to import peptides, supporting intracellular survival .

  • Synergy with Chaperones: Co-expression with TF or GroEL-GroES improves solubility, as demonstrated for similar E. coli-produced proteins .

Pathogenic Role

Nutrient Acquisition and Immune Evasion

  • Peptide Transport: Facilitates nutrient uptake in nutrient-poor host environments .

  • Immune Suppression: Repression of ABC transporters during early infection minimizes host detection, enabling persistent colonization .

Host-Pathogen Interactions
While direct interactions of BMEII0207/BMEII0208 with host proteins remain uncharacterized, ABC transporters in Brucella are implicated in modulating host immune pathways (e.g., NF-κB and MAPK signaling) .

Applications in Biomedical Research

Diagnostic and Therapeutic Potential

  • Vaccine Development: As a surface-exposed protein, BMEII0207/BMEII0208 could serve as a target for subunit vaccines .

  • Drug Targets: Inhibiting ABC transporters may disrupt nutrient acquisition, offering novel therapeutic strategies .

ELISA and Antibody Development
Recombinant BMEII0207/BMEII0208 is used in ELISA kits to detect anti-Brucella antibodies, aiding in serological diagnostics .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will accommodate your needs if possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery times.
Note: Our proteins are standardly shipped with normal blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development if possible.
Synonyms
BMEII0207/BMEII0208; Putative peptide transport system permease protein BMEII0207/BMEII0208
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-296
Protein Length
full length protein
Species
Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)
Target Names
BMEII0207/BMEII0208
Target Protein Sequence
MTELASPTSFSMPDIGKSPVVLTARRLMRHRSFRIGLVLLLIVVLAAVLAPWITNGKPNA TSVRMRFQPPGLEHLFGTDNFGRDLWTRVLYGAQVSLWIGLTVAVLSAILGAIIGIAAAW YRRFDTLLMRVMDALMAFPAILLAIGISAALGPHLSSVIIALTSAYIPRCARIVRASALV LRETDYVDAARLAGASDLRIITRHILPNCLAPLLVTLTFVFAYAILAEATLSFLGIGTPP PHASWGSIVAQGRDYSVDAWWIMLFPGIAITISALAINLIGDGLRDVLDPRLKMEG
Uniprot No.

Target Background

Function
This protein is likely a component of an ABC transporter complex potentially involved in peptide import. It is probably responsible for the translocation of the substrate across the membrane.
Database Links
Protein Families
Binding-protein-dependent transport system permease family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of BMEII0207/BMEII0208 in Brucella melitensis?

BMEII0207/BMEII0208 functions as a putative peptide transport system permease protein in Brucella melitensis biotype 1. Based on structural and functional analyses of similar bacterial transport systems, this protein likely participates in the transmembrane transport of peptides, serving as a channel component that allows peptides to cross the bacterial membrane. The protein is believed to be part of the machinery responsible for nutrient acquisition, particularly nitrogen sources in the form of peptides, which is essential for bacterial growth and survival. Similar to other permease proteins in peptide transporters, BMEII0207/BMEII0208 likely contributes to bacterial virulence and persistence within the host environment .

How does BMEII0207/BMEII0208 relate to other peptide transport systems in bacteria?

BMEII0207/BMEII0208 belongs to the broader family of bacterial peptide transporters, which fall into two major categories: proton motive force-driven transporters (POT/PTR family) and ATP-binding cassette (ABC) transporters. Based on the nomenclature and functional characteristics, BMEII0207/BMEII0208 may be related to ABC transporters similar to the YejABEF system, which has been demonstrated to be crucial for antimicrobial peptide resistance and virulence in Brucella melitensis .

The comparison of transport systems across bacterial species reveals conserved structural elements despite sequence variations:

Transport System TypeEnergy SourceTypical StructureCommon inPeptide Preference
POT/PTR FamilyProton motive force12-18 transmembrane domainsMost bacteria, not archaeaDi- and tripeptides
ABC TransportersATP hydrolysisMultiple proteins with ATP-binding domainsWidespread across bacteriaVarious peptide lengths
BMEII0207/BMEII0208 (Putative)Likely ATPPermease component of multi-protein complexBrucella melitensisUnder investigation

Similar peptide transporters play critical roles in bacterial nutrition and virulence, indicating that BMEII0207/BMEII0208 may have comparable physiological significance in Brucella melitensis .

What expression systems are most effective for producing recombinant BMEII0207/BMEII0208?

Several expression systems have been successfully employed for the recombinant production of BMEII0207/BMEII0208, each with distinct advantages for different research applications:

  • Cell-Free Expression System: This system provides rapid protein production without the complications of cell culture and is particularly useful for initial characterization studies or when the protein might be toxic to host cells .

  • E. coli Expression System: The most common and cost-effective approach, suitable for large-scale production when the protein folds correctly in this host .

  • Yeast, Baculovirus, or Mammalian Cell Systems: These eukaryotic expression systems may provide better post-translational modifications and protein folding for complex membrane proteins like BMEII0207/BMEII0208 .

For optimal results, researchers should consider:

  • The intended use of the recombinant protein (structural studies, functional assays, antibody production)

  • Required protein purity (≥85% purity can be achieved as determined by SDS-PAGE)

  • Scale of production needed

  • Time constraints

  • Available laboratory resources

A common methodological approach involves testing expression in multiple systems at small scale before committing to larger-scale production in the optimal system.

What purification strategies are recommended for recombinant BMEII0207/BMEII0208?

Purification of recombinant BMEII0207/BMEII0208 requires special consideration due to its nature as a membrane protein. An effective purification protocol would typically include:

  • Membrane Fraction Isolation: After cell lysis, differential centrifugation to isolate membrane fractions containing the expressed protein.

  • Solubilization: Carefully selected detergents to extract the protein from membranes without denaturing it. Common detergents include n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), or digitonin.

  • Affinity Chromatography: If the recombinant protein contains an affinity tag (His, GST, FLAG), corresponding affinity resins can be used for initial purification.

  • Size Exclusion Chromatography (SEC): For further purification and to assess the protein's oligomeric state.

  • Quality Control: SDS-PAGE analysis to confirm ≥85% purity, western blotting to verify identity, and functional assays to ensure the protein retains its transport capabilities .

The selection of detergents is particularly critical, as inappropriate detergent choice can result in protein denaturation or aggregation, compromising both structural and functional studies.

How does the structure of BMEII0207/BMEII0208 relate to its function in peptide transport?

While the specific structure of BMEII0207/BMEII0208 has not been fully characterized, insights can be drawn from related peptide transporters. The protein likely contains multiple transmembrane domains that form a channel for peptide passage across the membrane. By analogy with other peptide transporters like PepT2, several structural features may be critical for function:

  • Transmembrane Helices: These form the core transport channel and undergo conformational changes during the transport cycle.

  • Substrate Binding Pocket: Likely contains conserved residues that interact with peptide substrates, potentially including acidic residues (Asp, Glu) that interact with the peptide N-terminus and basic residues that interact with the C-terminus .

  • Extracellular and Intracellular Gates: These regulate substrate access and release during the alternating access mechanism of transport.

  • Interaction Domains: Surfaces that mediate interactions with other components of the transport system.

The structural basis for substrate selectivity likely involves specific residues in the binding pocket that determine which peptides can be transported. Advanced structural studies using techniques such as cryo-EM (as has been done for PepT2) could provide crucial insights into the structure-function relationship of BMEII0207/BMEII0208 .

What methodologies are most effective for studying the in vivo role of BMEII0207/BMEII0208 in Brucella pathogenesis?

Investigating the in vivo role of BMEII0207/BMEII0208 in Brucella pathogenesis requires a multi-faceted approach:

  • Generation of Gene Deletion Mutants:

    • Precise deletion of BMEII0207, BMEII0208, or both genes using homologous recombination

    • Creation of complemented strains to verify phenotypes are due to the specific deletions

    • Construction of conditional mutants if complete deletion is lethal

  • In Vitro Virulence Assays:

    • Sensitivity testing to antimicrobial peptides (similar to polymyxin B testing used for YejABEF)

    • Acid resistance assays to assess survival in acidic environments (pH 4.5-5.5) that mimic phagolysosomal conditions

    • Macrophage infection assays to evaluate invasion and intracellular replication capacity

  • In Vivo Infection Models:

    • Mouse infection models to assess bacterial clearance from tissues (particularly spleen and liver)

    • Measurement of bacterial burden at different time points post-infection

    • Histopathological examination of infected tissues

  • Transcriptomic and Proteomic Analyses:

    • RNA-seq to identify genes differentially expressed in mutant vs. wild-type strains

    • Proteomics to characterize changes in protein expression profiles

    • Metabolomics to identify alterations in peptide transport and metabolism

Based on studies of similar transport systems, researchers should pay particular attention to:

  • Resistance to host antimicrobial peptides

  • Survival under nutrient limitation conditions

  • Ability to establish and maintain chronic infection

How can researchers effectively design experiments to identify the specific peptide substrates of BMEII0207/BMEII0208?

Identifying the specific peptide substrates of BMEII0207/BMEII0208 requires systematic approaches:

  • Competitive Transport Assays:

    • Use of radiolabeled or fluorescently labeled reporter peptides

    • Competition with unlabeled peptide libraries to identify those that compete for transport

    • Measurement of transport kinetics (Km, Vmax) for different peptides

  • Direct Binding Assays:

    • Surface plasmon resonance (SPR) with purified protein

    • Isothermal titration calorimetry (ITC) to determine binding affinities

    • Microscale thermophoresis (MST) for detecting interactions in solution

  • Structural Analysis of Substrate Binding:

    • Co-crystallization of the protein with potential peptide substrates

    • Cryo-EM studies of protein-substrate complexes

    • Computational docking and molecular dynamics simulations

  • Optimal Experimental Design (OPEX) Approach:

    • Implementation of machine learning models to guide experimental design

    • Systematic exploration of experimental space for efficient discovery

    • Identification of informative experiments that maximize knowledge gain with minimal data collection

A methodical approach might involve:

PhaseMethodologyExpected OutcomeAnalysis Method
1: Broad ScreeningTransport assays with diverse peptide librariesIdentification of general substrate preferencesStatistical comparison of transport rates
2: RefinementFocused testing of similar peptidesDefinition of structural requirements for transportStructure-activity relationship analysis
3: ValidationSite-directed mutagenesis of binding pocket residuesConfirmation of specific substrate interactionsTransport assays with mutant proteins
4: In vivo ConfirmationGrowth assays with defined peptides as sole nitrogen sourceVerification of physiological relevanceGrowth curve analysis

This systematic approach allows for efficient characterization of substrate specificity without exhaustive testing of all possible peptide combinations .

What is the relationship between BMEII0207/BMEII0208 and antimicrobial peptide resistance in Brucella melitensis?

The relationship between BMEII0207/BMEII0208 and antimicrobial peptide resistance may parallel that observed with the YejABEF ABC transporter in Brucella melitensis. Research investigating this relationship should address:

  • Susceptibility Testing:

    • Determination of minimum inhibitory concentrations (MICs) of various antimicrobial peptides against wild-type and BMEII0207/BMEII0208 deletion mutants

    • Time-kill assays to assess killing kinetics

    • Membrane permeability assays to evaluate membrane integrity

  • Mechanistic Investigations:

    • Assessment of whether BMEII0207/BMEII0208 directly transports antimicrobial peptides away from their site of action

    • Evaluation of potential indirect effects on membrane composition or charge

    • Investigation of regulatory connections with other resistance mechanisms

  • Transcriptional Regulation:

    • Analysis of BMEII0207/BMEII0208 expression in response to antimicrobial peptide exposure

    • Identification of regulatory elements controlling expression

    • Characterization of cross-regulation with other stress response systems

Evidence from related systems suggests that ABC transporters like YejABEF contribute significantly to antimicrobial peptide resistance. Deletion mutants show increased sensitivity to polymyxin B and acidic stress, suggesting that these transporters play crucial roles in survival within the hostile host environment .

Comparative data might reveal patterns such as:

StrainPolymyxin B MIC (μg/ml)Survival in Acidic pH (%)Macrophage Survival (CFU)Mouse Clearance Time (days)
Wild-type B. melitensis25-5075-8510^5-10^6>30
ΔBMEII0207/BMEII0208 (predicted)3-1215-3010^3-10^47-14
ΔYejABEF (known data)6.2520-2510^3-10^47-14

Understanding this relationship could provide insights into bacterial adaptation to host defenses and potential targets for therapeutic intervention .

How can structural biology techniques be optimized for studying BMEII0207/BMEII0208 as a membrane protein?

Structural characterization of membrane proteins like BMEII0207/BMEII0208 presents significant challenges that can be addressed through optimized methodologies:

  • Protein Expression and Stabilization:

    • Screening multiple expression systems to identify optimal yield and folding

    • Engineering fusion proteins or truncations to enhance stability

    • Systematic detergent screening to identify conditions that maintain native structure

    • Use of nanodiscs or amphipols as alternatives to conventional detergents

  • Crystallization Approaches:

    • Lipidic cubic phase (LCP) crystallization, which has been successful for many membrane proteins

    • Surface entropy reduction through targeted mutations

    • Co-crystallization with antibody fragments or nanobodies to provide crystal contacts

    • Screening of hundreds of conditions with varying precipitants, pH, and additives

  • Cryo-EM Optimization:

    • Vitrification condition optimization to achieve thin, uniform ice

    • Sample concentration adjustments to achieve optimal particle distribution

    • Use of Volta phase plates to enhance contrast

    • Implementation of advanced image processing techniques to handle conformational heterogeneity

  • Complementary Techniques:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map conformational dynamics

    • Electron paramagnetic resonance (EPR) spectroscopy with site-directed spin labeling

    • Molecular dynamics simulations to model protein-lipid interactions

Based on successful approaches with related transporters like PepT2, researchers should consider:

  • Capturing different conformational states (outward-open, occluded, inward-open) to understand the transport cycle

  • Analyzing domain motions and flexibility, particularly of extracellular domains that might capture peptides

  • Focusing on binding pocket architecture to understand substrate specificity

What approaches can be used to analyze the interplay between BMEII0207/BMEII0208 and host immune responses during infection?

Investigating the interplay between BMEII0207/BMEII0208 and host immune responses requires multilevel analysis:

  • Host Cell Response Analysis:

    • Transcriptomic profiling of infected host cells (comparing wild-type vs. ΔBMEII0207/BMEII0208)

    • Measurement of cytokine and chemokine production

    • Analysis of pathogen recognition receptor activation

    • Assessment of phagosome maturation and intracellular trafficking

  • In Vivo Immune Response Characterization:

    • Flow cytometry to analyze immune cell populations during infection

    • Histopathological examination of infected tissues

    • Adoptive transfer experiments to identify key immune cell types

    • Cytokine neutralization studies to determine critical immune mediators

  • Molecular Interaction Studies:

    • Pull-down assays to identify host proteins that interact with BMEII0207/BMEII0208

    • Yeast two-hybrid or mammalian two-hybrid screens for interaction partners

    • BRET/FRET assays to confirm interactions in living cells

    • Immunoprecipitation followed by mass spectrometry to identify complexes

  • Targeted Analysis of Antimicrobial Peptide Interactions:

    • Direct binding assays between BMEII0207/BMEII0208 and host antimicrobial peptides

    • Localization studies to track the fate of antimicrobial peptides in infected cells

    • Competitive inhibition studies to determine specificity

Based on studies with similar systems, researchers should pay particular attention to:

  • Interactions with host antimicrobial peptides

  • Modulation of phagolysosomal maturation

  • Alterations in host cell gene expression profiles

  • Changes in immune cell recruitment and activation

How can researchers design mutation studies to identify critical functional domains in BMEII0207/BMEII0208?

A systematic approach to identify critical functional domains in BMEII0207/BMEII0208 through mutation studies should include:

  • Sequence-Based Domain Prediction:

    • Multiple sequence alignment with homologous proteins to identify conserved regions

    • Use of predictive algorithms to identify transmembrane regions, binding domains, and functional motifs

    • Identification of residues conserved across species, suggesting functional importance

  • Strategic Mutation Design:

    • Alanine scanning mutagenesis of conserved residues

    • Charge reversal mutations of key acidic or basic residues

    • Domain swapping with related transporters to identify specificity determinants

    • Construction of chimeric proteins with other peptide transporters

  • Functional Characterization of Mutants:

    • Transport assays using reporter peptides to measure activity

    • Growth complementation assays in auxotrophic strains

    • Antimicrobial peptide resistance assays

    • Protein expression and localization analysis to ensure proper folding and trafficking

  • Structural Validation:

    • Molecular modeling based on homologous structures

    • Limited proteolysis to identify domain boundaries

    • Hydrogen-deuterium exchange mass spectrometry to map structural changes

A methodical approach should focus on key regions such as:

  • Putative peptide binding sites (based on analogy with PepT2 or similar transporters)

  • Transmembrane domains involved in forming the transport channel

  • Domains involved in protein-protein interactions with other transport system components

  • Regions potentially involved in energy coupling

What statistical approaches are most appropriate for analyzing peptide transport data for BMEII0207/BMEII0208?

Robust statistical analysis of peptide transport data requires consideration of multiple factors:

  • Experimental Design Considerations:

    • Implement randomized block designs to control for batch effects

    • Include appropriate positive and negative controls in each experiment

    • Perform power analysis to determine adequate sample sizes

    • Consider factorial designs when testing multiple variables (e.g., peptide length, charge, hydrophobicity)

  • Data Preprocessing:

    • Normalize transport data to account for variations in protein expression levels

    • Apply appropriate transformations (log, square root) to achieve normality if needed

    • Identify and handle outliers through robust statistical methods

    • Implement quality control measures to identify technical variability

  • Statistical Analysis Methods:

    • For comparing transport rates of different peptides: ANOVA followed by appropriate post-hoc tests

    • For dose-response relationships: Nonlinear regression to determine Km and Vmax values

    • For multiple variable analysis: Multiple regression or response surface methodology

    • For complex datasets: Machine learning approaches such as random forests or support vector machines

  • Advanced Statistical Approaches:

    • Bayesian hierarchical modeling to account for experimental variability

    • Time series analysis for kinetic transport data

    • Meta-analysis techniques when combining data across multiple studies

    • Optimal experimental design methods like OPEX to efficiently explore the experimental space

The optimal approach often involves:

  • Clear definition of the specific hypotheses being tested

  • Selection of appropriate statistical tests based on data distribution and experimental design

  • Rigorous validation using independent datasets or cross-validation

  • Transparent reporting of all statistical methods and assumptions

How can researchers effectively integrate structural, functional, and in vivo data to build a comprehensive model of BMEII0207/BMEII0208 function?

Building a comprehensive model of BMEII0207/BMEII0208 function requires integration of multiple data types:

  • Data Collection and Organization:

    • Systematic compilation of structural data (cryo-EM, crystallography, molecular modeling)

    • Functional data from in vitro transport assays

    • In vivo pathogenesis data from infection models

    • Expression data under various conditions

  • Multi-Scale Modeling Approaches:

    • Molecular dynamics simulations to understand conformational changes during transport

    • Systems biology modeling of transport kinetics

    • Host-pathogen interaction modeling incorporating immune response data

    • Integration into broader metabolic network models of Brucella

  • Data Integration Methods:

    • Bayesian network approaches to identify relationships between variables

    • Machine learning techniques to identify patterns across datasets

    • Graph-based data integration to visualize relationships

    • Multi-omics data integration frameworks

  • Iterative Model Refinement:

    • Generation of testable hypotheses from preliminary models

    • Experimental validation of key model predictions

    • Model refinement based on new experimental data

    • Sensitivity analysis to identify key parameters and assumptions

A proposed workflow might include:

StageData TypesIntegration MethodsExpected Outcomes
1Sequence and structural predictionHomology modeling, secondary structure predictionInitial structural model
2In vitro functional dataKinetic modeling, substrate specificity analysisFunctional characterization
3Expression and regulation dataNetwork analysis, transcription factor binding predictionRegulatory model
4In vivo infection dataSystems biology modeling, immune response integrationPathogenesis model
5All data typesComprehensive multi-scale modelingIntegrated functional model

The success of this approach depends on careful experimental design, rigorous data analysis, and iterative refinement of models based on experimental validation .

What are the best practices for studying potential interactions between BMEII0207/BMEII0208 and other components of Brucella transport systems?

Investigating interactions between BMEII0207/BMEII0208 and other transport components requires a systematic approach:

  • Identification of Potential Interaction Partners:

    • Bioinformatic analysis of gene neighborhood and operonic structure

    • Co-expression analysis to identify genes with correlated expression patterns

    • Protein-protein interaction predictions based on homology to known complexes

    • Literature mining for related transport systems

  • Physical Interaction Assays:

    • Co-immunoprecipitation with tagged versions of BMEII0207/BMEII0208

    • Bacterial two-hybrid or split-ubiquitin assays for membrane protein interactions

    • Cross-linking mass spectrometry to identify interaction interfaces

    • Blue native PAGE to preserve native complexes during separation

  • Functional Interaction Studies:

    • Genetic interaction mapping through synthetic lethality or suppressor screens

    • Epistasis analysis with double mutants

    • Complementation studies with chimeric proteins

    • Transport assays with reconstituted systems of varying composition

  • Structural Analysis of Complexes:

    • Cryo-EM of purified complexes

    • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

    • FRET/BRET assays to monitor interactions in live cells

    • Computational docking and molecular dynamics simulations

Based on what is known about bacterial peptide transporters, researchers should focus on:

  • Interactions with ATP-binding domains if BMEII0207/BMEII0208 is part of an ABC transporter system

  • Potential interactions with substrate-binding proteins that might recognize and deliver peptides

  • Regulatory proteins that might modulate transport activity

  • Connections to other membrane proteins involved in stress response or virulence

What are the main technical challenges in studying BMEII0207/BMEII0208, and how can they be overcome?

Research on BMEII0207/BMEII0208 faces several significant technical challenges:

  • Membrane Protein Expression and Purification:

    • Challenge: Low expression levels and potential toxicity to host cells

    • Solutions:

      • Use of specialized expression systems (C41/C43 E. coli strains)

      • Inducible expression systems with tight regulation

      • Fusion tags that enhance solubility and membrane targeting

      • Systematic screening of detergents for optimal extraction

  • Functional Assays for Transport Activity:

    • Challenge: Developing reliable assays for peptide transport

    • Solutions:

      • Reconstitution into proteoliposomes or nanodiscs

      • Development of fluorescent or radiolabeled reporter peptides

      • Use of pH-sensitive fluorophores to monitor proton coupling

      • Implementation of high-throughput screening platforms

  • Working with Brucella as a Biosafety Level 3 Pathogen:

    • Challenge: Safety requirements limit experimental approaches

    • Solutions:

      • Development of attenuated strains for lower containment levels

      • Use of heterologous expression in non-pathogenic hosts

      • Computational approaches to complement limited experimental options

      • Collaboration with specialized BSL-3 facilities

  • Structural Analysis of Dynamic Transport Process:

    • Challenge: Capturing multiple conformational states

    • Solutions:

      • Use of conformation-specific nanobodies or antibody fragments

      • Application of time-resolved cryo-EM techniques

      • Strategic mutations to stabilize specific conformations

      • Molecular dynamics simulations to model transitions

The field would benefit from:

  • Development of specialized tools for membrane protein research

  • Standardized protocols for functional characterization

  • Collaborative approaches combining multiple techniques

  • Improved computational methods for predicting membrane protein structure and function

How might the study of BMEII0207/BMEII0208 contribute to broader understanding of bacterial peptide transport and pathogenesis?

The study of BMEII0207/BMEII0208 has significant potential to advance multiple fields:

Comparative analysis might reveal evolutionary patterns:

AspectBMEII0207/BMEII0208 (Brucella)YejABEF (Brucella)PepT Systems (Other Bacteria)PepT2 (Mammals)
StructureUnder investigationMulti-component ABC transporterDiverse family of transportersCryo-EM structure available
FunctionPutative peptide transportAMP resistance, virulenceNutrient acquisitionPeptide reabsorption
Role in PathogenesisTo be determinedCritical for virulenceVaries by speciesN/A
Evolutionary ConservationWithin Brucella speciesHighly conservedDiverse familyDistinct but related

This comparative approach could reveal fundamental principles of peptide transport across diverse biological systems .

What emerging technologies or methodologies might significantly advance research on BMEII0207/BMEII0208 in the next five years?

Several emerging technologies hold promise for advancing research on BMEII0207/BMEII0208:

  • Advanced Structural Biology Techniques:

    • Cryo-electron tomography for in situ structural analysis

    • Micro-electron diffraction (MicroED) for structure determination from nanocrystals

    • Integrative structural biology combining multiple data sources

    • Time-resolved structural methods to capture transport dynamics

  • Single-Molecule Approaches:

    • Single-molecule FRET to monitor conformational changes during transport

    • Atomic force microscopy to measure protein-substrate interactions

    • Nanopore-based single-molecule transport assays

    • Super-resolution microscopy for localization and dynamics studies

  • Advanced Computational Methods:

    • AlphaFold and other AI-based structure prediction tools for membrane proteins

    • Enhanced sampling molecular dynamics for modeling conformational changes

    • Deep learning approaches for predicting protein-protein and protein-substrate interactions

    • Quantum mechanical/molecular mechanical (QM/MM) methods for modeling transport mechanisms

  • System-Level Approaches:

    • CRISPRi/CRISPRa for genome-wide functional screening

    • Single-cell transcriptomics during infection

    • Metabolic flux analysis to quantify peptide transport in vivo

    • Multi-omics integration through advanced computational frameworks

    • Optimal experimental design (OPEX) approaches to maximize knowledge gain from minimal experiments

  • Synthetic Biology Tools:

    • Engineered biosensors for real-time monitoring of transport activity

    • Cell-free expression systems for rapid protein engineering

    • Synthetic cells or vesicles for controlled transport studies

    • PACE (phage-assisted continuous evolution) for directed evolution of transport proteins

The integration of these technologies could transform our understanding of BMEII0207/BMEII0208 function and provide new strategies for therapeutic intervention in Brucella infections.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.