Recombinant Brucella melitensis biotype 1 Putative peptide transport system permease protein BMEII0209 (BMEII0209)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it during order placement. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and protein stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
BMEII0209; Putative peptide transport system permease protein BMEII0209
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-315
Protein Length
full length protein
Species
Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)
Target Names
BMEII0209
Target Protein Sequence
MMTALILKRVAQAIPVMLIVAILTFLLMKLLPGDPAILIAGDGASPETVERIRVELGLDQ PTVVQLGQWLWNLFHFDLGRSFLLSQPVSQAIAERLPVTISLALLAFAITIPVGIIMGVV AAYLRDSWFDTGVMSLALLGVSVPSFWLAILAVILFSVTLGWFPSAGYVPFLDSPLGWLR SLILPASILALFQIGYLARMTRSEMLEVMDQDYIRTARSKGVSEYSVLSTHAFRNALVSV LTVSGYIFSLLIGGSVVIEQIFALPGLGRLLVQAILARDLPVVQGTMLFLGFLFVAINVL VDILYTIADPRVRYD
Uniprot No.

Target Background

Function
Likely part of an ABC transporter complex involved in peptide import. It is probably responsible for translocating the substrate across the membrane.
Database Links
Protein Families
Binding-protein-dependent transport system permease family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and basic properties of BMEII0209?

BMEII0209 is a full-length (315 amino acids) putative peptide transport system permease protein from Brucella melitensis biotype 1. The protein has a UniProt ID of Q8YDG7 and functions as a component of an ATP-Binding Cassette (ABC) transport system . The protein contains multiple transmembrane domains, consistent with its role as a permease, and its complete amino acid sequence is: "MMTALILKRVAQAIPVMLIVAILTFLLMKLLPGDPAILIAGDGASPETVERIRVELGLDQPTVVQLGQWLWNLFHFDLGRSFLLSQPVSQAIAERLPVTISLALLAFAITIPVGIIMGVVAAYLRDSWFDTGVMSLALLGVSVPSFWLAILAVILFSVTLGWFPSAGYVPFLDSPLGWLRSLILPASILALFQIGYLARMTRSEMLEVMDQDYIRTARSKGVSEYSVLSTHAFRNALVSVLTVSGYIFSLLIGGSVVIEQIFALPGLGRLLVQAILARDLPVVQGTMLFLGFLFVAINVLVDILYTIADPRVRYD" . When recombinantly produced, it is typically expressed in E. coli with an N-terminal His-tag to facilitate purification and laboratory studies .

What role does BMEII0209 play in the Brucella transport system?

BMEII0209 (also annotated as dppB in some literature) functions within a dipeptide import system in Brucella melitensis . As a permease component of an ABC transporter, it forms part of the membrane channel through which peptides are transported into the bacterial cell. The protein works in conjunction with other components of the ABC transporter complex, including ATP-binding proteins that provide energy for transport and substrate-binding proteins that capture peptides from the extracellular environment . ABC transporters are essential for nutrient acquisition in Brucella species, which explains the high number of these systems identified across different Brucella genomes (B. melitensis contains 79 functional ABC systems) .

What methodologies are most effective for expressing and purifying recombinant BMEII0209 for structural studies?

For effective expression and purification of recombinant BMEII0209, researchers should employ the following methodological approach:

  • Expression System: Use E. coli as the heterologous expression host with an N-terminal His-tag fusion for detection and purification .

  • Purification Protocol:

    • Extract using affinity chromatography with Ni-NTA or similar matrices

    • Achieve >90% purity as confirmed by SDS-PAGE analysis

    • Consider using detergents for membrane protein solubilization

  • Storage Recommendations:

    • Store purified protein at -20°C/-80°C

    • Aliquot to avoid freeze-thaw cycles

    • For working stocks, maintain at 4°C for up to one week

  • Reconstitution Method:

    • Centrifuge lyophilized protein vial before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol (5-50%, typically 50%) for long-term storage

    • Use Tris/PBS-based buffer with 6% Trehalose, pH 8.0 as storage buffer

For structural studies, researchers should consider additional steps such as protein stabilization in appropriate detergent micelles or lipid nanodiscs, particularly important for membrane proteins like BMEII0209.

How does the quorum sensing system regulate BMEII0209 expression in Brucella melitensis?

The expression of transport proteins, including ABC transporters like BMEII0209, appears to be regulated by the quorum sensing (QS) system in Brucella melitensis. Research indicates that two key LuxR-type transcriptional regulators, VjbR and BabR, play crucial roles in this regulation .

VjbR and BabR often exert opposite effects on their target genes:

RegulatorEffect on ABC TransportersConfirmation Method
VjbRActivates many transport systemsTranscriptomic and proteomic analyses
BabROften represses the same targetsqRT-PCR validation

Specifically, genes involved in amino acid and sugar transport are part of the QS regulon, suggesting that QS initiates a metabolic switch in Brucella . The regulation of transport systems by QS appears to be part of a broader adaptation strategy that includes changes in central metabolism, cell wall/envelope biogenesis, and virulence factor expression .

Experimental evidence for this regulation comes from comparative proteomic and transcriptomic analyses of wild-type B. melitensis 16M versus isogenic ΔvjbR and ΔbabR mutants, revealing significant differences in protein abundance for numerous transporters .

What experimental approaches can be used to determine the substrate specificity of BMEII0209?

Determining the substrate specificity of BMEII0209 requires a multi-faceted experimental approach:

  • Genetic Knockout Studies:

    • Create BMEII0209 deletion mutants using gene replacement techniques (similar to methods used for vjbR mutants)

    • Assess growth phenotypes on various peptide sources

    • Compare transport efficiencies between wild-type and mutant strains

  • Transport Assays:

    • Reconstitute purified BMEII0209 into proteoliposomes

    • Use radiolabeled or fluorescently tagged peptides to measure transport

    • Analyze kinetic parameters (Km, Vmax) for different peptide substrates

  • Binding Studies:

    • Implement isothermal titration calorimetry (ITC)

    • Use surface plasmon resonance (SPR) to measure binding affinities

    • Screen peptide libraries to identify preferential binding partners

  • Structural Analysis:

    • Perform X-ray crystallography or cryo-EM of BMEII0209 with bound substrates

    • Use computational docking to predict substrate interactions

    • Validate predictions with site-directed mutagenesis of key binding residues

These approaches should be used in combination to develop a comprehensive understanding of the substrate range and transport mechanisms of BMEII0209.

How might BMEII0209 contribute to Brucella virulence and pathogenesis?

BMEII0209, as a component of peptide transport systems, likely contributes to Brucella virulence through several mechanisms:

  • Nutrient Acquisition: The high number of ABC transporters in Brucella species that cause human brucellosis (e.g., B. melitensis with 79 systems) compared to non-human pathogens (e.g., B. ovis with 59 systems) suggests these transporters provide a competitive advantage during infection . BMEII0209 may help bacteria acquire essential peptides from host environments.

  • Adaptation to Intracellular Lifestyle: As an intracellular pathogen, Brucella must adapt to nutrient-limited conditions within host cells. Transport systems regulated by quorum sensing, including BMEII0209, appear central to this metabolic adaptation .

  • Coordination with Virulence Mechanisms: Research shows that the same quorum sensing regulators (VjbR and BabR) that control transport protein expression also regulate known virulence factors such as the Type IV Secretion System (T4SS) . This suggests a coordinated regulation between nutrient acquisition and virulence expression.

  • Potential for Host Immune Evasion: By regulating cell envelope composition through control of transport systems, Brucella may alter surface properties to evade host immune detection or resist antimicrobial compounds.

The absence of certain ABC systems in B. ovis (which doesn't cause human brucellosis) compared to B. melitensis provides additional evidence that these transporters, including BMEII0209, may be crucial for human pathogenicity .

What potential does BMEII0209 hold as a therapeutic target or vaccine component?

BMEII0209 presents several characteristics that make it a promising candidate for therapeutic intervention or vaccine development:

  • Surface Expression: As a membrane permease, portions of BMEII0209 are exposed at the bacterial surface, making them potentially accessible to antibodies or inhibitors .

  • Essential Function: If BMEII0209 is essential for nutrient acquisition during infection, inhibiting its function could starve the pathogen of required nutrients.

  • Conservation and Specificity: The protein is conserved across Brucella species that cause human disease but has low homology to human proteins, reducing potential cross-reactivity concerns .

  • Differential Presence: Its presence in human-pathogenic Brucella but potentially different configuration in non-human pathogens suggests it may contribute to human virulence specifically .

Research approaches for therapeutic development should include:

ApproachMethodologyPotential Outcome
Inhibitor DevelopmentStructure-based drug design targeting the substrate binding siteSmall molecule therapeutics
Antibody TargetingGeneration of antibodies against surface-exposed epitopesPassive immunization strategies
Vaccine ComponentInclusion in subunit or recombinant vaccinesPreventative immunity
CRISPR-Based TargetingDesign of CRISPR-Cas systems to specifically target BMEII0209 geneNovel antimicrobial approach

The successful development of BMEII0209-targeting therapeutics would require careful validation of its essentiality in vivo and demonstration that inhibition leads to attenuation of bacterial virulence.

What are the critical considerations for working with recombinant BMEII0209 in laboratory settings?

When working with recombinant BMEII0209 in research settings, several technical considerations must be addressed:

  • Protein Stability Management:

    • Avoid repeated freeze-thaw cycles which compromise protein integrity

    • Aliquot purified protein immediately after reconstitution

    • Store working aliquots at 4°C for maximum one week

    • Maintain long-term storage at -20°C/-80°C with 50% glycerol

  • Reconstitution Protocol:

    • Centrifuge the vial before opening to collect all material

    • Use deionized sterile water for initial reconstitution

    • Achieve concentration of 0.1-1.0 mg/mL

    • Ensure complete solubilization before experimental use

  • Buffer Compatibility:

    • The protein is stable in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

    • When changing buffers, monitor protein stability and function

    • Consider detergent inclusion for membrane protein stability

  • Quality Control Metrics:

    • Verify protein purity (>90%) by SDS-PAGE

    • Confirm identity by Western blot using anti-His antibodies

    • Assess functional integrity through appropriate activity assays

  • Biosafety Considerations:

    • While the recombinant protein itself is not infectious, follow institutional guidelines for handling Brucella-derived proteins

    • Work in appropriate biosafety cabinets when necessary

Following these guidelines will help ensure experimental reproducibility and reliable results when working with this challenging membrane protein.

How can functional assays be designed to evaluate BMEII0209 transport activity?

Designing robust functional assays for BMEII0209 transport activity requires careful consideration of its membrane protein nature and specific transport function:

  • Proteoliposome-Based Transport Assays:

    • Reconstitute purified BMEII0209 into artificial liposomes

    • Include other ABC transporter components (ATP-binding proteins, substrate-binding proteins)

    • Load liposomes with appropriate buffers reflecting physiological conditions

    • Measure uptake of labeled peptide substrates over time

    • Compare transport rates with and without ATP to confirm active transport

  • Whole-Cell Transport Systems:

    • Express BMEII0209 and partner proteins in transport-deficient E. coli strains

    • Measure uptake of radiolabeled or fluorescent peptides

    • Compare wild-type versus mutant versions to identify critical residues

  • Electrophysiological Methods:

    • Incorporate BMEII0209 into planar lipid bilayers or patch-clamp systems

    • Measure changes in membrane conductance upon substrate addition

    • Determine ion coupling mechanisms if present

  • ATPase Activity Coupling:

    • Measure ATP hydrolysis rates in reconstituted systems

    • Correlate ATPase activity with transport function

    • Determine how substrate binding affects ATP hydrolysis

  • Competition Assays:

    • Use unlabeled peptides to compete with labeled substrates

    • Determine substrate preference hierarchy

    • Identify structural features important for recognition

These assays should be validated using known inhibitors or mutations that disrupt transport function, and results should be reproducible across multiple experimental setups.

What genomic and proteomic approaches can advance our understanding of BMEII0209 regulation and function?

Advanced genomic and proteomic approaches offer promising avenues to further elucidate BMEII0209 regulation and function:

  • Transcriptomic Analysis:

    • RNA-Seq under various growth conditions and infection models

    • Compare expression between wild-type and quorum sensing mutants (ΔvjbR and ΔbabR)

    • Identify co-regulated genes within the same operon or regulon

  • ChIP-Seq Analysis:

    • Map direct binding of VjbR and BabR to the BMEII0209 promoter region

    • Identify DNA binding motifs and regulatory elements

    • Determine if regulation is direct or indirect

  • Ribosome Profiling:

    • Assess translational efficiency under different conditions

    • Identify potential post-transcriptional regulation

    • Compare with transcriptomic data to find discrepancies

  • Quantitative Proteomics:

    • Use techniques similar to the 2D-DIGE approach described for QS regulon analysis

    • Compare protein levels across different growth phases and stress conditions

    • Identify post-translational modifications that may affect function

  • Protein-Protein Interaction Studies:

    • Identify other components of the ABC transporter complex

    • Map interactions with regulatory proteins

    • Screen for host proteins that may interact during infection

  • Metabolomic Integration:

    • Connect transport activity with metabolic pathways

    • Identify how nutrient acquisition through BMEII0209 affects global metabolism

    • Link to the observed metabolic switch regulated by quorum sensing

These approaches should ideally be integrated to develop a systems-level understanding of BMEII0209 within the broader context of Brucella pathogenesis.

How might structural biology approaches contribute to understanding BMEII0209 transport mechanisms?

Structural biology approaches would significantly advance our understanding of BMEII0209 transport mechanisms through several key methodologies:

  • X-ray Crystallography:

    • Determine high-resolution structures of BMEII0209 in different conformational states

    • Capture substrate-bound and substrate-free states

    • Identify key residues involved in substrate recognition and transport

    • Challenges include obtaining crystals of membrane proteins, which may require specialized detergents or lipidic cubic phase methods

  • Cryo-Electron Microscopy (Cryo-EM):

    • Visualize the complete ABC transporter complex including BMEII0209

    • Capture dynamic conformational changes during transport cycle

    • Resolve structures without crystallization, overcoming a major hurdle in membrane protein structural biology

  • Nuclear Magnetic Resonance (NMR) Spectroscopy:

    • Analyze dynamics and conformational changes in solution

    • Study specific domains or fragments if the full protein proves challenging

    • Investigate interactions with substrates and partner proteins

  • Molecular Dynamics Simulations:

    • Model protein behavior in lipid bilayer environments

    • Simulate substrate translocation pathways

    • Predict effects of mutations on structure and function

    • Test hypotheses that can guide experimental design

  • Single-Molecule FRET:

    • Track real-time conformational changes during transport

    • Measure kinetics of individual transport steps

    • Correlate structural changes with functional outcomes

By combining these approaches, researchers could develop a comprehensive model of how BMEII0209 participates in peptide transport, potentially revealing novel mechanisms for targeting this system therapeutically.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.