Recombinant Brucella melitensis biotype 1 Putative phosphotransferase BMEI2060 (BMEI2060)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Brucella melitensis biotype 1 putative phosphotransferase BMEI2060 (BMEI2060) is a purified protein derived from the phosphotransferase system (PTS) of Brucella melitensis, a facultative intracellular pathogen causing brucellosis. This enzyme belongs to a regulatory PTS pathway involved in carbohydrate metabolism and virulence regulation in α-proteobacteria . Unlike canonical PTS systems, Brucella lacks PTS permeases, suggesting a specialized role in signaling rather than sugar transport .

Protein Sequence and Domains

  • Amino Acid Sequence:
    MSIFPAQPSDKKAVEEGAAFMPRFDASGLITAIVTDARDGELLMVAHMNEEALRLTLETGIAHYWSRSRKTLWKKGETSGNLQSVVELRTDCDQDALWLKVHVAGDGPTCHTGRRSCFYRQVVSSGGKVALTMASDHDQ .

  • Molecular Weight: ~16 kDa (139 amino acids) .

  • Conserved Motifs: Contains a histidine-containing phosphocarrier (HPr) domain, typical of PTS proteins involved in phosphoryl transfer .

Enzymatic Classification

  • EC Number: Likely classified under EC 2.7.4.28 (phosphotransferase activity) .

  • Function: Transfers phosphoryl groups between metabolic intermediates, potentially regulating carbon/nitrogen metabolism and virulence pathways .

Research Applications

ParameterDetails
Expression SystemRecombinant protein produced in E. coli .
Purity>85% (verified by SDS-PAGE) .
ApplicationsWestern blotting, ELISA, protein interaction studies .
StorageTris-based buffer with 50% glycerol; stable at -20°C/-80°C for 12 months .

Role in PTS Signaling

  • BMEI2060 is part of a four-protein phosphorelay (EINtr, NPr, EIIANtr, EIIAMan) that transfers phosphate from phosphoenolpyruvate (PEP) to downstream targets .

  • Key Interactions:

    • Binds inorganic pyrophosphatase and SucA (2-oxoglutarate dehydrogenase), linking PTS activity to central metabolism .

    • Regulates virulence factors like the VirB type IV secretion system (T4SS), critical for intracellular survival .

Link to Virulence

  • Mutations in PTS components (e.g., EINtr, NPr) reduce VirB protein synthesis and cause a small-colony phenotype, indicating fitness costs during infection .

  • Transcriptional linkage to BvrR-BvrS, a two-component system essential for host cell invasion, suggests cross-regulation .

Comparative Genomic Analysis

OrganismOrthologFunction
Brucella melitensisBMEI2060Phosphoryl transfer, virulence regulation
Escherichia coliEI (EC 2.7.4.28)PEP-dependent sugar transport regulation
Caulobacter crescentusCtrACell cycle and differentiation

Current Research Gaps and Future Directions

  • Mechanistic Studies: The precise substrates and regulatory targets of BMEI2060 remain uncharacterized.

  • In Vivo Validation: While Tn-seq screens identify PTS genes as critical for macrophage survival , direct evidence for BMEI2060’s role in murine or human infection is lacking.

  • Therapeutic Potential: Targeting BMEI2060 could disrupt Brucella’s metabolic adaptation in host cells, but inhibitor design requires structural data .

Product Specs

Form
Lyophilized powder. We will ship the available format, but you can specify a format when ordering.
Lead Time
Delivery time varies. Consult local distributors for specifics. Proteins are shipped with blue ice packs. Request dry ice in advance (extra fees apply).
Notes
Avoid repeated freeze-thaw cycles. Working aliquots are stable at 4°C for up to one week.
Reconstitution
Briefly centrifuge the vial before opening. Reconstitute in sterile deionized water to 0.1-1.0 mg/mL. Add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%.
Shelf Life
Shelf life depends on storage conditions, buffer, temperature, and protein stability. Liquid form: 6 months at -20°C/-80°C. Lyophilized form: 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing. Specify your preferred tag type when ordering, and we will prioritize its development.
Synonyms
BMEI2060; Putative pyruvate; phosphate dikinase regulatory protein; PPDK regulatory protein; EC 2.7.11.32; EC 2.7.4.27
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-279
Protein Length
full length protein
Purity
>85% (SDS-PAGE)
Species
Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)
Target Names
BMEI2060
Target Protein Sequence
MTRPLSYFHL HLISDATGET LLAAGRAAAA QYANARAIEH IYPLIRTEKQ LRKVLEGIDA EPGIVLYTVV DQKLAAIIDE SCADMGVPSV SVLEPVLNTF QSYLGAPAHR RASAQHVLNA DYFRRIDALN FMMEHDDGQL PLDIEEADVI IVGISRTSKT PTSIYLANRG IKAANVPLVL GIPVPEILFA AKRPLIVGLV ATAERISQIR QNRPLGNIPS LDTGLYTDRV SISEELAYAR NLCNRHGWPI IDVSRRSIEE TAAAILALLR NGKKEGSSS
Uniprot No.

Target Background

Function
Bifunctional serine/threonine kinase and phosphorylase that regulates pyruvate, phosphate dikinase (PPDK) activity through phosphorylation/dephosphorylation.
Database Links
Protein Families
Pyruvate, phosphate/water dikinase regulatory protein family, PDRP subfamily

Q&A

What expression systems are most effective for producing recombinant BMEI2060?

Effective expression of recombinant BMEI2060 requires careful selection of an appropriate system based on protein characteristics and experimental needs. For bacterial expression, E. coli BL21(DE3) represents a primary choice, mirroring successful approaches used with other Brucella proteins like Omp31 . The methodological workflow should include:

  • Gene isolation from Brucella melitensis biotype 1 genomic DNA using PCR with high-fidelity polymerase

  • Cloning into pET-series vectors with N-terminal or C-terminal affinity tags (His6, GST)

  • Transformation into E. coli JM109 for plasmid propagation followed by BL21(DE3) for expression

  • Expression optimization through systematic variation of:

    • Induction temperature (18–37°C)

    • IPTG concentration (0.1–1.0 mM)

    • Induction duration (3–24 hours)

    • Media composition (LB, TB, or auto-induction media)

For proteins demonstrating toxicity or forming inclusion bodies, consider alternative approaches including:

  • Use of tightly regulated promoters (T7lac, araBAD)

  • Expression in specialized E. coli strains (Rosetta for rare codons, Origami for disulfide formation)

  • Mammalian or insect cell expression systems for complex post-translational modifications

What purification strategies yield the highest purity and activity for recombinant BMEI2060?

Purification of recombinant BMEI2060 requires a multi-step approach to ensure both purity and biological activity:

  • Initial capture:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged protein

    • Glutathione affinity for GST-fusion proteins

    • Sample preparation: cell lysis by sonication or high-pressure homogenization in buffer containing protease inhibitors

  • Intermediate purification:

    • Ion exchange chromatography based on BMEI2060's theoretical isoelectric point

    • Tag removal using specific proteases (TEV, thrombin, Factor Xa) if necessary

    • Buffer optimization to maintain enzyme stability and activity

  • Polishing:

    • Size exclusion chromatography to remove aggregates and ensure homogeneity

    • Concentration using ultrafiltration devices with appropriate molecular weight cutoff

  • Quality control:

    • SDS-PAGE and Western blot analysis to confirm purity and identity

    • Activity assays to confirm functional integrity

    • Endotoxin testing for samples intended for immunological studies

For phosphotransferases specifically, include phosphatase inhibitors (sodium orthovanadate, sodium fluoride) throughout purification to prevent dephosphorylation events that could compromise activity measurements .

How can researchers determine if biotype variations affect BMEI2060 structure and function?

Investigation of biotype-specific variations in BMEI2060 requires a comparative approach:

  • Sequence analysis:

    • PCR amplification and sequencing of BMEI2060 from B. melitensis biotype 1 and biotype 3 isolates

    • Multiple sequence alignment to identify amino acid substitutions

    • Phylogenetic analysis to determine evolutionary relationships

  • Structural comparison:

    • Homology modeling based on crystal structures of related phosphotransferases

    • In silico analysis of how sequence variations might affect protein folding or active sites

    • Circular dichroism spectroscopy to compare secondary structure elements

  • Functional assessment:

    • Recombinant expression of BMEI2060 variants from different biotypes

    • Comparative enzyme kinetics (Km, Vmax, substrate specificity)

    • Thermal stability and pH optima determination

  • Biological significance:

    • Creation of chimeric proteins to map functional domains

    • Complementation studies in knockout strains

    • Virulence assessment in cellular infection models

When interpreting results, consider that biotype differences may be subtle but functionally significant, as observed in antimicrobial susceptibility variations between B. melitensis biotypes 1 and 3 .

How should experiments be designed to evaluate BMEI2060's potential as a vaccine candidate?

Evaluation of BMEI2060 as a vaccine candidate requires a systematic approach similar to that used for other Brucella antigens like Omp31 :

  • Immunogenicity assessment:

    • Immunization protocol: Recombinant BMEI2060 (50-100 μg/dose) administered with incomplete Freund's adjuvant at days 0 and 15

    • Control groups: (a) adjuvant only, (b) killed whole-cell B. melitensis in adjuvant

    • Serum collection at 15, 30, 45, 60, and 75 days post-immunization

    • Analysis of antibody responses by ELISA (titer, isotype distribution, IgG subclass pattern)

  • Cellular immunity characterization:

    • Spleen cell isolation from immunized mice

    • In vitro stimulation with rBMEI2060

    • Cytokine profiling (IL-2, IFN-γ, IL-10, IL-4) to determine Th1/Th2 balance

    • Flow cytometric analysis of T-cell activation markers

  • Protection studies:

    • Challenge with virulent B. melitensis (intravenous route) 30 days after final immunization

    • Bacterial load determination in spleen at defined time points

    • Comparison with established vaccine candidates

  • Mechanism investigation:

    • In vivo T-cell subset depletion using monoclonal antibodies

    • Adoptive transfer experiments

    • Identification of protective epitopes through peptide mapping

Experimental GroupImmunization ProtocolChallenge StrainProtection Level (log10 CFU reduction)Immune Response Profile
rBMEI2060 + IFA50 μg, Days 0 & 15B. melitensis H38STo be determinedExpected: Th1-dominant with CD4+ response
Control (PBS + IFA)Days 0 & 15B. melitensis H38SNo protection expectedExpected: No specific response
Killed B. melitensis + IFA8×10^8 bacteria, Day 0B. melitensis H38SExpected: 2.0-3.0 log reductionExpected: Mixed Th1/Th2

What approaches can determine if BMEI2060 contributes to Brucella melitensis virulence?

Investigating BMEI2060's role in virulence requires complementary genetic and functional approaches:

  • Construction of defined mutants:

    • Generation of BMEI2060 deletion mutant using suicide vector technology

    • Complementation with wild-type gene to confirm phenotype specificity

    • Creation of point mutants targeting predicted catalytic residues

  • In vitro infection models:

    • Macrophage infection assays (murine J774.A1, RAW264.7, or primary cells)

    • Assessment of intracellular survival and replication curves

    • Evaluation of phagosome-lysosome fusion events

    • Cytokine induction profile in infected cells

  • In vivo virulence assessment:

    • Mouse model infection (BALB/c) via appropriate route

    • Bacterial load quantification in target organs (spleen, liver)

    • Histopathological evaluation

    • Immune response characterization

  • Molecular mechanisms:

    • Transcriptomics to identify BMEI2060-dependent gene expression

    • Phosphoproteomics to identify substrates

    • Protein-protein interaction studies using co-immunoprecipitation

    • Subcellular localization under different environmental conditions

The experimental design should include appropriate controls, including wild-type bacteria and mutants in known virulence factors, with sufficient biological and technical replicates for statistical validity.

How can structure-function relationships in BMEI2060 be analyzed to identify potential inhibitor binding sites?

Structure-function analysis of BMEI2060 for inhibitor development requires:

  • Structural characterization:

    • X-ray crystallography of purified rBMEI2060

    • Alternative approaches: NMR spectroscopy for dynamic regions, cryo-EM for complex assemblies

    • Homology modeling if experimental structures prove challenging

    • Molecular dynamics simulations to identify flexible regions

  • Functional domain mapping:

    • Site-directed mutagenesis of predicted catalytic residues

    • Truncation analysis to identify minimal functional units

    • Chimeric proteins with homologous phosphotransferases

    • Activity assays correlated with structural alterations

  • Inhibitor binding site identification:

    • Computational cavity detection algorithms

    • Fragment-based screening approaches

    • Thermal shift assays to identify stabilizing compounds

    • Co-crystallization with substrate analogs or initial hit compounds

  • Rational inhibitor design strategy:

    • Structure-based virtual screening of compound libraries

    • Molecular docking to prioritize candidates

    • Medicinal chemistry optimization of initial hits

    • Validation through enzyme inhibition assays

This approach can identify unique structural features absent in human phosphotransferases, enabling development of selective inhibitors with therapeutic potential against brucellosis.

What controls and experimental design considerations are essential when evaluating BMEI2060 enzyme activity?

Rigorous evaluation of BMEI2060 phosphotransferase activity requires careful experimental design:

  • Essential controls:

    • Positive control: Well-characterized phosphotransferase with similar activity

    • Negative controls: (a) heat-inactivated enzyme, (b) catalytically inactive mutant

    • Background controls: reaction components without enzyme

    • Substrate specificity controls: structurally related non-substrate molecules

  • Reaction condition optimization:

    • pH profile determination (pH 5.0-9.0 in 0.5 increments)

    • Temperature optimization (4-60°C)

    • Buffer composition screening (HEPES, Tris, phosphate)

    • Divalent cation requirements (Mg²⁺, Mn²⁺, Ca²⁺, Zn²⁺)

  • Kinetic parameter determination:

    • Initial velocity measurements under steady-state conditions

    • Substrate concentration series (0.1-10× Km)

    • Lineweaver-Burk, Eadie-Hofstee, or non-linear regression analysis

    • Product inhibition studies

  • Detection method selection:

    • Colorimetric assays for phosphate release

    • Coupled enzyme assays for real-time monitoring

    • Radioactive assays for highest sensitivity

    • Mass spectrometry for direct product identification

Data should be presented with appropriate statistical analysis (mean ± standard deviation from ≥3 independent experiments) and graphical representation showing both raw data and derived parameters.

How can researchers overcome challenges in producing soluble, active BMEI2060?

Addressing solubility challenges for recombinant BMEI2060 requires a systematic troubleshooting approach:

  • Expression vector modifications:

    • Testing fusion partners known to enhance solubility (MBP, SUMO, TrxA, GST)

    • Codon optimization for expression host

    • Signal sequence addition for periplasmic targeting

    • Expression of individual domains rather than full-length protein

  • Host strain selection:

    • BL21(DE3) derivatives enhanced for difficult proteins:

      • BL21(DE3)pLysS for toxic proteins

      • Rosetta for rare codon usage

      • SHuffle/Origami for disulfide bond formation

    • Alternative hosts (Pseudomonas, Brevibacillus) for problematic proteins

  • Culture condition optimization:

    • Systematic temperature reduction (37°C → 30°C → 25°C → 18°C)

    • Inducer concentration titration

    • Addition of chemical chaperones (sorbitol, glycerol, arginine)

    • Co-expression with molecular chaperones (GroEL/ES, DnaK/J)

  • If inclusion bodies persist, refolding strategies:

    • Solubilization in chaotropic agents (8M urea, 6M guanidine-HCl)

    • Refolding by dialysis, dilution, or on-column methods

    • Redox buffer systems for disulfide formation

    • Refolding additive screening (L-arginine, glycerol, sucrose)

Each modification should be evaluated systematically with quantification of soluble protein yield and specific activity to identify optimal conditions.

What methodological approaches can determine if BMEI2060 interacts with host cell targets during infection?

Investigating BMEI2060 interactions with host targets requires multiple complementary approaches:

  • Identification of potential interactions:

    • Yeast two-hybrid screening against human/mouse cDNA libraries

    • Affinity purification-mass spectrometry (AP-MS)

    • Proximity-dependent biotin identification (BioID)

    • Computational prediction based on structural motifs

  • Validation of specific interactions:

    • Co-immunoprecipitation with tagged BMEI2060

    • Pull-down assays with recombinant proteins

    • Surface plasmon resonance for binding kinetics

    • ELISA-based binding assays

  • Functional relevance assessment:

    • Mutagenesis of interaction interfaces

    • Competitive inhibition with peptides or small molecules

    • RNAi knockdown of host targets

    • CRISPR/Cas9 knockout/modification of host targets

  • Visualization of interactions:

    • Immunofluorescence co-localization in infected cells

    • Förster resonance energy transfer (FRET)

    • Bimolecular fluorescence complementation

    • Live-cell imaging with fluorescently tagged proteins

For each identified interaction, researchers should establish biological significance by demonstrating effects on bacterial survival, replication, or host cell responses when the interaction is disrupted.

How should researchers interpret differences in immune responses between BMEI2060 and other Brucella antigens?

Comparative interpretation of immune responses requires systematic analysis:

  • Antibody response comparison:

    • Total IgG titer analysis across antigens

    • IgG subclass distribution (IgG1/IgG2a ratio as Th2/Th1 indicator)

    • Epitope specificity mapping

    • Functional activity (opsonization, neutralization)

  • T-cell response analysis:

    • Cytokine profile comparison (IL-2, IFN-γ vs IL-4, IL-10)

    • CD4⁺ vs CD8⁺ T-cell contribution

    • Memory T-cell generation

    • Cross-reactivity with other antigens

  • Protection correlation:

    • Statistical correlation between specific immune parameters and protection

    • Multivariate analysis to identify predictive immune signatures

    • Comparative protection against different Brucella species/strains

    • Duration of protective immunity

  • Mechanistic investigation:

    • In vivo depletion studies to determine critical immune components

    • Passive transfer experiments to assess antibody contribution

    • Cytokine neutralization to determine functional relevance

    • Adoptive transfer of specific T-cell populations

Research with Omp31 demonstrated that protection against B. melitensis was primarily mediated by CD4⁺ T cells with limited CD8⁺ T cell contribution , establishing a useful comparative benchmark for BMEI2060 studies.

What statistical approaches are most appropriate for analyzing BMEI2060 vaccine efficacy data?

Robust statistical analysis of vaccine efficacy requires appropriate methods:

  • For bacterial burden comparison:

    • Log transformation of CFU data to achieve normal distribution

    • One-way ANOVA with post-hoc tests (Tukey, Bonferroni) for multiple group comparisons

    • Non-parametric alternatives (Kruskal-Wallis, Mann-Whitney) for non-normally distributed data

    • Presentation as mean log₁₀ CFU ± standard error with individual data points

  • For immune response correlation:

    • Pearson or Spearman correlation between immune parameters and protection

    • Multiple regression to identify predictive variables

    • Principal component analysis for complex immunological datasets

    • Receiver operating characteristic (ROC) analysis for biomarker evaluation

  • Power and sample size considerations:

    • A priori power analysis to determine adequate group sizes

    • Effect size calculation based on preliminary data or similar published studies

    • Consideration of biological vs. statistical significance

    • Transparent reporting of all exclusion criteria

  • Advanced statistical approaches:

    • Mixed-effects models for longitudinal data

    • Survival analysis for time-to-event outcomes

    • Bayesian methods for integrating prior knowledge

    • Machine learning for complex pattern recognition in multiparameter data

How can researchers resolve contradictory findings between in vitro activity and in vivo protective efficacy of BMEI2060?

Resolving contradictions between in vitro and in vivo results requires systematic investigation:

  • Methodological validation:

    • Confirm protein activity/stability under physiological conditions

    • Verify that in vitro assays accurately reflect in vivo function

    • Ensure animal models appropriately mimic human disease

    • Validate challenge strains and doses

  • Mechanistic exploration:

    • Investigate if BMEI2060 requires processing or modification in vivo

    • Examine whether immune recognition differs between in vitro and in vivo settings

    • Assess bioavailability and tissue distribution

    • Determine if host factors modulate BMEI2060 activity

  • Alternative hypotheses testing:

    • Evaluate indirect vs. direct protective mechanisms

    • Consider adjuvant contributions to observed effects

    • Investigate strain-specific responses

    • Assess temporal factors in protection development

  • Bridging experiments:

    • Ex vivo studies with cells from immunized animals

    • Passive transfer of immune components

    • Adoptive transfer of specific cell populations

    • Hybrid approaches combining in vitro and in vivo elements

Similar contradictions have been observed with other Brucella antigens, where antibodies against Omps provided poor protection against smooth Brucella strains in mice despite strong in vitro binding, possibly due to O-polysaccharide interference with epitope accessibility .

What approaches can address poor immunogenicity of recombinant BMEI2060 in vaccine studies?

Systematic troubleshooting of poor immunogenicity includes:

  • Protein quality assessment:

    • Confirm native conformation through circular dichroism

    • Verify absence of degradation by mass spectrometry

    • Assess aggregation state by dynamic light scattering

    • Evaluate endotoxin contamination

  • Formulation optimization:

    • Test alternative adjuvants beyond IFA (CpG, monophosphoryl lipid A, aluminum salts)

    • Evaluate antigen delivery systems (liposomes, nanoparticles, virus-like particles)

    • Optimize antigen dose (typically 50-100 μg for subunit vaccines)

    • Consider different routes of administration (subcutaneous, intradermal, mucosal)

  • Immunization schedule modifications:

    • Increase number of booster doses

    • Extend intervals between immunizations

    • Implement heterologous prime-boost strategies

    • Consider adjuvant priming before antigen delivery

  • Epitope enhancement:

    • Identify and amplify immunodominant epitopes

    • Create synthetic peptide constructs targeting protective epitopes

    • Test multi-epitope vaccines combining BMEI2060 with other antigens

    • Engineer modifications to increase epitope processing/presentation

Research with Omp31 demonstrated that a synthetic peptide containing amino acids 48-74 elicited protective immunity comparable to the full-length protein , suggesting that epitope-focused approaches may overcome immunogenicity limitations.

How can researchers distinguish between direct effects of BMEI2060 and indirect effects in virulence studies?

Establishing direct causality in virulence studies requires:

  • Genetic complementation approaches:

    • Clean deletion mutant construction (ΔbmeiI2060)

    • Complementation with wild-type gene (ΔbmeiI2060 + bmeiI2060)

    • Complementation with catalytically inactive mutant (ΔbmeiI2060 + bmeiI2060*)

    • Inducible expression systems to control timing and level

  • Biochemical validation:

    • Identification of direct BMEI2060 substrates

    • Demonstration of substrate modification in vitro

    • Correlation between substrate phosphorylation and virulence phenotypes

    • Phosphoproteomics to track global changes

  • Temporal analysis:

    • Time-course experiments establishing sequence of events

    • Conditional expression/deletion systems

    • Real-time monitoring of bacterial-host interactions

    • Synchronized infection models

  • Molecular dissection:

    • Domain-specific mutations affecting distinct functions

    • Separation-of-function alleles

    • Structure-guided mutagenesis targeting catalytic vs. binding sites

    • Heterologous expression to test function in isolation

Experimental design should include all appropriate controls and multiple measurements at different time points to establish causality rather than correlation.

What methodological adaptations can overcome non-reproducibility in BMEI2060 functional assays between laboratories?

Addressing inter-laboratory variability requires standardization and troubleshooting:

  • Protocol standardization:

    • Detailed standard operating procedures with explicit parameters

    • Preparation of common reagents or centralized reagent distribution

    • Calibrated equipment and validated reference standards

    • Round-robin testing between participating laboratories

  • Critical variable identification:

    • Systematic variation of experimental parameters:

      • Protein preparation methods

      • Buffer compositions and pH

      • Incubation times and temperatures

      • Detection system sensitivity and specificity

    • Design of experiments (DOE) approach to identify critical variables

  • Biological source considerations:

    • Verification of BMEI2060 sequence across laboratories

    • Standardized expression systems and purification protocols

    • Common B. melitensis strains for functional studies

    • Standard cell lines and culture conditions for host-pathogen studies

  • Data sharing and analysis:

    • Raw data repositories for comparative analysis

    • Transparent reporting of all experimental details

    • Meta-analysis of multiple datasets

    • Statistical approaches to identify systematic biases

These methodological considerations are essential for generating reproducible data with recombinant proteins, where variations in protein preparation can significantly impact experimental outcomes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.