Recombinant Brucella melitensis biotype 1 putative phosphotransferase BMEI2060 (BMEI2060) is a purified protein derived from the phosphotransferase system (PTS) of Brucella melitensis, a facultative intracellular pathogen causing brucellosis. This enzyme belongs to a regulatory PTS pathway involved in carbohydrate metabolism and virulence regulation in α-proteobacteria . Unlike canonical PTS systems, Brucella lacks PTS permeases, suggesting a specialized role in signaling rather than sugar transport .
Amino Acid Sequence:
MSIFPAQPSDKKAVEEGAAFMPRFDASGLITAIVTDARDGELLMVAHMNEEALRLTLETGIAHYWSRSRKTLWKKGETSGNLQSVVELRTDCDQDALWLKVHVAGDGPTCHTGRRSCFYRQVVSSGGKVALTMASDHDQ .
Conserved Motifs: Contains a histidine-containing phosphocarrier (HPr) domain, typical of PTS proteins involved in phosphoryl transfer .
EC Number: Likely classified under EC 2.7.4.28 (phosphotransferase activity) .
Function: Transfers phosphoryl groups between metabolic intermediates, potentially regulating carbon/nitrogen metabolism and virulence pathways .
BMEI2060 is part of a four-protein phosphorelay (EINtr, NPr, EIIANtr, EIIAMan) that transfers phosphate from phosphoenolpyruvate (PEP) to downstream targets .
Key Interactions:
Mutations in PTS components (e.g., EINtr, NPr) reduce VirB protein synthesis and cause a small-colony phenotype, indicating fitness costs during infection .
Transcriptional linkage to BvrR-BvrS, a two-component system essential for host cell invasion, suggests cross-regulation .
Mechanistic Studies: The precise substrates and regulatory targets of BMEI2060 remain uncharacterized.
In Vivo Validation: While Tn-seq screens identify PTS genes as critical for macrophage survival , direct evidence for BMEI2060’s role in murine or human infection is lacking.
Therapeutic Potential: Targeting BMEI2060 could disrupt Brucella’s metabolic adaptation in host cells, but inhibitor design requires structural data .
KEGG: bme:BMEI2060
STRING: 224914.BAWG_0188
Effective expression of recombinant BMEI2060 requires careful selection of an appropriate system based on protein characteristics and experimental needs. For bacterial expression, E. coli BL21(DE3) represents a primary choice, mirroring successful approaches used with other Brucella proteins like Omp31 . The methodological workflow should include:
Gene isolation from Brucella melitensis biotype 1 genomic DNA using PCR with high-fidelity polymerase
Cloning into pET-series vectors with N-terminal or C-terminal affinity tags (His6, GST)
Transformation into E. coli JM109 for plasmid propagation followed by BL21(DE3) for expression
Expression optimization through systematic variation of:
Induction temperature (18–37°C)
IPTG concentration (0.1–1.0 mM)
Induction duration (3–24 hours)
Media composition (LB, TB, or auto-induction media)
For proteins demonstrating toxicity or forming inclusion bodies, consider alternative approaches including:
Use of tightly regulated promoters (T7lac, araBAD)
Expression in specialized E. coli strains (Rosetta for rare codons, Origami for disulfide formation)
Mammalian or insect cell expression systems for complex post-translational modifications
Purification of recombinant BMEI2060 requires a multi-step approach to ensure both purity and biological activity:
Initial capture:
Immobilized metal affinity chromatography (IMAC) for His-tagged protein
Glutathione affinity for GST-fusion proteins
Sample preparation: cell lysis by sonication or high-pressure homogenization in buffer containing protease inhibitors
Intermediate purification:
Ion exchange chromatography based on BMEI2060's theoretical isoelectric point
Tag removal using specific proteases (TEV, thrombin, Factor Xa) if necessary
Buffer optimization to maintain enzyme stability and activity
Polishing:
Size exclusion chromatography to remove aggregates and ensure homogeneity
Concentration using ultrafiltration devices with appropriate molecular weight cutoff
Quality control:
SDS-PAGE and Western blot analysis to confirm purity and identity
Activity assays to confirm functional integrity
Endotoxin testing for samples intended for immunological studies
For phosphotransferases specifically, include phosphatase inhibitors (sodium orthovanadate, sodium fluoride) throughout purification to prevent dephosphorylation events that could compromise activity measurements .
Investigation of biotype-specific variations in BMEI2060 requires a comparative approach:
Sequence analysis:
Structural comparison:
Homology modeling based on crystal structures of related phosphotransferases
In silico analysis of how sequence variations might affect protein folding or active sites
Circular dichroism spectroscopy to compare secondary structure elements
Functional assessment:
Recombinant expression of BMEI2060 variants from different biotypes
Comparative enzyme kinetics (Km, Vmax, substrate specificity)
Thermal stability and pH optima determination
Biological significance:
Creation of chimeric proteins to map functional domains
Complementation studies in knockout strains
Virulence assessment in cellular infection models
When interpreting results, consider that biotype differences may be subtle but functionally significant, as observed in antimicrobial susceptibility variations between B. melitensis biotypes 1 and 3 .
Evaluation of BMEI2060 as a vaccine candidate requires a systematic approach similar to that used for other Brucella antigens like Omp31 :
Immunogenicity assessment:
Immunization protocol: Recombinant BMEI2060 (50-100 μg/dose) administered with incomplete Freund's adjuvant at days 0 and 15
Control groups: (a) adjuvant only, (b) killed whole-cell B. melitensis in adjuvant
Serum collection at 15, 30, 45, 60, and 75 days post-immunization
Analysis of antibody responses by ELISA (titer, isotype distribution, IgG subclass pattern)
Cellular immunity characterization:
Spleen cell isolation from immunized mice
In vitro stimulation with rBMEI2060
Cytokine profiling (IL-2, IFN-γ, IL-10, IL-4) to determine Th1/Th2 balance
Flow cytometric analysis of T-cell activation markers
Protection studies:
Mechanism investigation:
In vivo T-cell subset depletion using monoclonal antibodies
Adoptive transfer experiments
Identification of protective epitopes through peptide mapping
| Experimental Group | Immunization Protocol | Challenge Strain | Protection Level (log10 CFU reduction) | Immune Response Profile |
|---|---|---|---|---|
| rBMEI2060 + IFA | 50 μg, Days 0 & 15 | B. melitensis H38S | To be determined | Expected: Th1-dominant with CD4+ response |
| Control (PBS + IFA) | Days 0 & 15 | B. melitensis H38S | No protection expected | Expected: No specific response |
| Killed B. melitensis + IFA | 8×10^8 bacteria, Day 0 | B. melitensis H38S | Expected: 2.0-3.0 log reduction | Expected: Mixed Th1/Th2 |
Investigating BMEI2060's role in virulence requires complementary genetic and functional approaches:
Construction of defined mutants:
Generation of BMEI2060 deletion mutant using suicide vector technology
Complementation with wild-type gene to confirm phenotype specificity
Creation of point mutants targeting predicted catalytic residues
In vitro infection models:
Macrophage infection assays (murine J774.A1, RAW264.7, or primary cells)
Assessment of intracellular survival and replication curves
Evaluation of phagosome-lysosome fusion events
Cytokine induction profile in infected cells
In vivo virulence assessment:
Molecular mechanisms:
Transcriptomics to identify BMEI2060-dependent gene expression
Phosphoproteomics to identify substrates
Protein-protein interaction studies using co-immunoprecipitation
Subcellular localization under different environmental conditions
The experimental design should include appropriate controls, including wild-type bacteria and mutants in known virulence factors, with sufficient biological and technical replicates for statistical validity.
Structure-function analysis of BMEI2060 for inhibitor development requires:
Structural characterization:
X-ray crystallography of purified rBMEI2060
Alternative approaches: NMR spectroscopy for dynamic regions, cryo-EM for complex assemblies
Homology modeling if experimental structures prove challenging
Molecular dynamics simulations to identify flexible regions
Functional domain mapping:
Site-directed mutagenesis of predicted catalytic residues
Truncation analysis to identify minimal functional units
Chimeric proteins with homologous phosphotransferases
Activity assays correlated with structural alterations
Inhibitor binding site identification:
Computational cavity detection algorithms
Fragment-based screening approaches
Thermal shift assays to identify stabilizing compounds
Co-crystallization with substrate analogs or initial hit compounds
Rational inhibitor design strategy:
Structure-based virtual screening of compound libraries
Molecular docking to prioritize candidates
Medicinal chemistry optimization of initial hits
Validation through enzyme inhibition assays
This approach can identify unique structural features absent in human phosphotransferases, enabling development of selective inhibitors with therapeutic potential against brucellosis.
Rigorous evaluation of BMEI2060 phosphotransferase activity requires careful experimental design:
Essential controls:
Positive control: Well-characterized phosphotransferase with similar activity
Negative controls: (a) heat-inactivated enzyme, (b) catalytically inactive mutant
Background controls: reaction components without enzyme
Substrate specificity controls: structurally related non-substrate molecules
Reaction condition optimization:
pH profile determination (pH 5.0-9.0 in 0.5 increments)
Temperature optimization (4-60°C)
Buffer composition screening (HEPES, Tris, phosphate)
Divalent cation requirements (Mg²⁺, Mn²⁺, Ca²⁺, Zn²⁺)
Kinetic parameter determination:
Initial velocity measurements under steady-state conditions
Substrate concentration series (0.1-10× Km)
Lineweaver-Burk, Eadie-Hofstee, or non-linear regression analysis
Product inhibition studies
Detection method selection:
Colorimetric assays for phosphate release
Coupled enzyme assays for real-time monitoring
Radioactive assays for highest sensitivity
Mass spectrometry for direct product identification
Data should be presented with appropriate statistical analysis (mean ± standard deviation from ≥3 independent experiments) and graphical representation showing both raw data and derived parameters.
Addressing solubility challenges for recombinant BMEI2060 requires a systematic troubleshooting approach:
Expression vector modifications:
Testing fusion partners known to enhance solubility (MBP, SUMO, TrxA, GST)
Codon optimization for expression host
Signal sequence addition for periplasmic targeting
Expression of individual domains rather than full-length protein
Host strain selection:
BL21(DE3) derivatives enhanced for difficult proteins:
BL21(DE3)pLysS for toxic proteins
Rosetta for rare codon usage
SHuffle/Origami for disulfide bond formation
Alternative hosts (Pseudomonas, Brevibacillus) for problematic proteins
Culture condition optimization:
Systematic temperature reduction (37°C → 30°C → 25°C → 18°C)
Inducer concentration titration
Addition of chemical chaperones (sorbitol, glycerol, arginine)
Co-expression with molecular chaperones (GroEL/ES, DnaK/J)
If inclusion bodies persist, refolding strategies:
Solubilization in chaotropic agents (8M urea, 6M guanidine-HCl)
Refolding by dialysis, dilution, or on-column methods
Redox buffer systems for disulfide formation
Refolding additive screening (L-arginine, glycerol, sucrose)
Each modification should be evaluated systematically with quantification of soluble protein yield and specific activity to identify optimal conditions.
Investigating BMEI2060 interactions with host targets requires multiple complementary approaches:
Identification of potential interactions:
Yeast two-hybrid screening against human/mouse cDNA libraries
Affinity purification-mass spectrometry (AP-MS)
Proximity-dependent biotin identification (BioID)
Computational prediction based on structural motifs
Validation of specific interactions:
Co-immunoprecipitation with tagged BMEI2060
Pull-down assays with recombinant proteins
Surface plasmon resonance for binding kinetics
ELISA-based binding assays
Functional relevance assessment:
Mutagenesis of interaction interfaces
Competitive inhibition with peptides or small molecules
RNAi knockdown of host targets
CRISPR/Cas9 knockout/modification of host targets
Visualization of interactions:
Immunofluorescence co-localization in infected cells
Förster resonance energy transfer (FRET)
Bimolecular fluorescence complementation
Live-cell imaging with fluorescently tagged proteins
For each identified interaction, researchers should establish biological significance by demonstrating effects on bacterial survival, replication, or host cell responses when the interaction is disrupted.
Comparative interpretation of immune responses requires systematic analysis:
Antibody response comparison:
T-cell response analysis:
Protection correlation:
Statistical correlation between specific immune parameters and protection
Multivariate analysis to identify predictive immune signatures
Comparative protection against different Brucella species/strains
Duration of protective immunity
Mechanistic investigation:
In vivo depletion studies to determine critical immune components
Passive transfer experiments to assess antibody contribution
Cytokine neutralization to determine functional relevance
Adoptive transfer of specific T-cell populations
Research with Omp31 demonstrated that protection against B. melitensis was primarily mediated by CD4⁺ T cells with limited CD8⁺ T cell contribution , establishing a useful comparative benchmark for BMEI2060 studies.
Robust statistical analysis of vaccine efficacy requires appropriate methods:
For bacterial burden comparison:
Log transformation of CFU data to achieve normal distribution
One-way ANOVA with post-hoc tests (Tukey, Bonferroni) for multiple group comparisons
Non-parametric alternatives (Kruskal-Wallis, Mann-Whitney) for non-normally distributed data
Presentation as mean log₁₀ CFU ± standard error with individual data points
For immune response correlation:
Pearson or Spearman correlation between immune parameters and protection
Multiple regression to identify predictive variables
Principal component analysis for complex immunological datasets
Receiver operating characteristic (ROC) analysis for biomarker evaluation
Power and sample size considerations:
A priori power analysis to determine adequate group sizes
Effect size calculation based on preliminary data or similar published studies
Consideration of biological vs. statistical significance
Transparent reporting of all exclusion criteria
Advanced statistical approaches:
Mixed-effects models for longitudinal data
Survival analysis for time-to-event outcomes
Bayesian methods for integrating prior knowledge
Machine learning for complex pattern recognition in multiparameter data
Resolving contradictions between in vitro and in vivo results requires systematic investigation:
Methodological validation:
Confirm protein activity/stability under physiological conditions
Verify that in vitro assays accurately reflect in vivo function
Ensure animal models appropriately mimic human disease
Validate challenge strains and doses
Mechanistic exploration:
Investigate if BMEI2060 requires processing or modification in vivo
Examine whether immune recognition differs between in vitro and in vivo settings
Assess bioavailability and tissue distribution
Determine if host factors modulate BMEI2060 activity
Alternative hypotheses testing:
Evaluate indirect vs. direct protective mechanisms
Consider adjuvant contributions to observed effects
Investigate strain-specific responses
Assess temporal factors in protection development
Bridging experiments:
Ex vivo studies with cells from immunized animals
Passive transfer of immune components
Adoptive transfer of specific cell populations
Hybrid approaches combining in vitro and in vivo elements
Similar contradictions have been observed with other Brucella antigens, where antibodies against Omps provided poor protection against smooth Brucella strains in mice despite strong in vitro binding, possibly due to O-polysaccharide interference with epitope accessibility .
Systematic troubleshooting of poor immunogenicity includes:
Protein quality assessment:
Confirm native conformation through circular dichroism
Verify absence of degradation by mass spectrometry
Assess aggregation state by dynamic light scattering
Evaluate endotoxin contamination
Formulation optimization:
Test alternative adjuvants beyond IFA (CpG, monophosphoryl lipid A, aluminum salts)
Evaluate antigen delivery systems (liposomes, nanoparticles, virus-like particles)
Optimize antigen dose (typically 50-100 μg for subunit vaccines)
Consider different routes of administration (subcutaneous, intradermal, mucosal)
Immunization schedule modifications:
Increase number of booster doses
Extend intervals between immunizations
Implement heterologous prime-boost strategies
Consider adjuvant priming before antigen delivery
Epitope enhancement:
Identify and amplify immunodominant epitopes
Create synthetic peptide constructs targeting protective epitopes
Test multi-epitope vaccines combining BMEI2060 with other antigens
Engineer modifications to increase epitope processing/presentation
Research with Omp31 demonstrated that a synthetic peptide containing amino acids 48-74 elicited protective immunity comparable to the full-length protein , suggesting that epitope-focused approaches may overcome immunogenicity limitations.
Establishing direct causality in virulence studies requires:
Genetic complementation approaches:
Clean deletion mutant construction (ΔbmeiI2060)
Complementation with wild-type gene (ΔbmeiI2060 + bmeiI2060)
Complementation with catalytically inactive mutant (ΔbmeiI2060 + bmeiI2060*)
Inducible expression systems to control timing and level
Biochemical validation:
Identification of direct BMEI2060 substrates
Demonstration of substrate modification in vitro
Correlation between substrate phosphorylation and virulence phenotypes
Phosphoproteomics to track global changes
Temporal analysis:
Time-course experiments establishing sequence of events
Conditional expression/deletion systems
Real-time monitoring of bacterial-host interactions
Synchronized infection models
Molecular dissection:
Domain-specific mutations affecting distinct functions
Separation-of-function alleles
Structure-guided mutagenesis targeting catalytic vs. binding sites
Heterologous expression to test function in isolation
Experimental design should include all appropriate controls and multiple measurements at different time points to establish causality rather than correlation.
Addressing inter-laboratory variability requires standardization and troubleshooting:
Protocol standardization:
Detailed standard operating procedures with explicit parameters
Preparation of common reagents or centralized reagent distribution
Calibrated equipment and validated reference standards
Round-robin testing between participating laboratories
Critical variable identification:
Systematic variation of experimental parameters:
Protein preparation methods
Buffer compositions and pH
Incubation times and temperatures
Detection system sensitivity and specificity
Design of experiments (DOE) approach to identify critical variables
Biological source considerations:
Verification of BMEI2060 sequence across laboratories
Standardized expression systems and purification protocols
Common B. melitensis strains for functional studies
Standard cell lines and culture conditions for host-pathogen studies
Data sharing and analysis:
Raw data repositories for comparative analysis
Transparent reporting of all experimental details
Meta-analysis of multiple datasets
Statistical approaches to identify systematic biases
These methodological considerations are essential for generating reproducible data with recombinant proteins, where variations in protein preparation can significantly impact experimental outcomes.