Recombinant Brucella melitensis biotype 1 Putative zinc metalloprotease BMEI0829 (BMEI0829)

Shipped with Ice Packs
In Stock

Description

Primary Structure

Expression and Purification

  • Host: Escherichia coli (prokaryotic expression system) .

  • Tag: N-terminal hexahistidine (His-tag) for affinity chromatography .

  • Purity: >90% as validated by SDS-PAGE .

  • Storage: Lyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0); stable at -20°C/-80°C .

ParameterDetails
UniProt IDQ8YHH1
Molecular Weight~42 kDa (calculated)
Catalytic MotifHEXXH (zinc-binding)
Expression VectorpET-28a(+) (prokaryotic)

Functional Role in Brucella Pathogenesis

BMEI0829 belongs to the zinc metalloprotease family, which plays critical roles in bacterial virulence and host-pathogen interactions:

Mechanistic Insights

  • Zinc-Dependent Activity: Utilizes a zinc ion coordinated by the HEXXH motif to hydrolyze peptide bonds, enabling proteolytic processing of host or bacterial substrates .

  • Intracellular Survival: Homologous zinc metalloproteases in Brucella abortus (e.g., BAB1_0270) facilitate intracellular adaptation by modulating stress response pathways and suppressing host immune defenses .

  • Operon Organization: Co-transcribed with a transcriptional regulator (HTH-Xre family), forming a toxin-antitoxin (TA) system implicated in stress resilience and genetic regulation .

Key Functional Domains

  • Catalytic Core: HEXXH motif and ψ-loop structure (β-sheet subdomains) essential for substrate binding .

  • Homology: Shares structural topology with ImmA/IrrE proteases, which cleave repressor proteins to activate stress-response genes .

Expression Systems

  • Prokaryotic Systems: High-yield production in E. coli BL21(DE3) using T7 promoter-driven vectors (e.g., pET-28a) .

  • Induction: Optimized with 0.1–1.0 mM IPTG at 16–37°C .

Purification Workflow

  1. Cell Lysis: Sonication in Tris/PBS buffer with lysozyme .

  2. Affinity Chromatography: Nickel-NTA resin for His-tag purification .

  3. Detoxification: Polymyxin-B columns to remove endotoxins .

Yield and Stability

  • Concentration: 7.2–9.4 mg/L in optimized cultures .

  • Reconstitution: Stable in 5–50% glycerol at -80°C .

Vaccine Development

  • Antigenicity: Recombinant Brucella proteins (e.g., Omp10-Omp28-L7/L12 fusion) elicit robust CD4+/CD8+ T-cell responses and antibody production in murine models .

  • Adjuvant Potential: Metalloproteases may enhance antigen presentation by modulating host protease activity .

Serodiagnostics

  • DIVA-Capable Assays: BMEI0829 and related antigens are candidates for differentiating infected from vaccinated animals (DIVA) .

Research Challenges and Future Directions

  • Catalytic Substrates: Unknown host or bacterial targets of BMEI0829 require identification .

  • Structural Biology: No crystallographic data exists; resolving 3D structure could inform inhibitor design .

  • Stress Adaptation: Role in acid tolerance (e.g., phagolysosomal survival) remains underexplored .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we understand your specific requirements. If you need a particular format, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
For proper reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference point for your own protocols.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
BMEI0829; Putative zinc metalloprotease BMEI0829
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-379
Protein Length
full length protein
Species
Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)
Target Names
BMEI0829
Target Protein Sequence
MQEALALFFGSESLLVGTIIPFLFVLTVVVFVHEMGHYLVARWCGIGAQAFSIGFGPELL GFTDRHGTRWKLSAIPLVGYVKFIGDESETSSPVGVNESALSEEDRKRAFHTQPVWKRAA TVFAGPAFNIILTIAIFSVFFALYGRQIADPLIAGVQPGSPAAEAGFEPGDRFVSVEGEK ITTFADVQRIVSGRAGDKLNFTVERDGKMVDLQAVPKIVERTDPLGNKVKLGAIGVETTE AVGNFRRIEYGPLESVGQAVIETGHIIGRTGEFFKRFAVGREDKCQLGGPVKIATMASKA ASQGFDWLIQLMAMLSIGIGLLNLFPLPPLDGGHLVFYAVEAIKGSPVSGAAQEIFYRIG FLLVMGFMGFVLFNDLFAC
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M50B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is BMEI0829 and what is its structural composition?

BMEI0829 is a putative zinc metalloprotease encoded in the genome of Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094). It has a UniProt accession number Q8YHH1 and comprises 379 amino acid residues with the complete sequence: MQEALALFFGSESLLVGTIIPFLFVLTVVVFVHEMGHYLVARWCGIGAQAFSIGFGPELLGFTDRHGTRWKLSAIPLVGYVKFIGDESETSSPVGVNESALSEEDRKRAFHTQPVWKRAATVFAGPAFNIILTIAIFSVFFALYGRQIADPLIAGVQPGSPAAEAGFEPGDRFVSVEGEKITTFADVQRIVSGRAGDKLNFTVERDGKMVDLQAVPKIVERTDPLGNKVKLGAIGVETTEAVGNFRRIEYGPLESVGQAVIETGHIIGRTGEFFKRFAVGREDKCQLGGPVKIATMASKAASQGFDWLIQLMAMLSIGIGLLNLFPLPPLDGGHLVFYAVEAIKGSPVSGAAQEIFYRIGFLLVMGFMGFVLFNDLFAC . The protein likely contains zinc-binding motifs characteristic of metalloproteases, and sequence analysis suggests it belongs to the EC 3.4.24.- enzyme classification group, indicating it functions as a metalloendopeptidase.

Like other bacterial zinc metalloproteases, BMEI0829 likely possesses three well-characterized zinc-binding and active-site motifs that are involved in catalytic activity . Comparative analysis with similar proteins suggests it may have a theoretical molecular weight of approximately 37,782 Da and a theoretical pI of 5.23, though these parameters should be experimentally verified for the recombinant protein.

How does BMEI0829 compare to other bacterial metalloproteases?

BMEI0829 shares significant sequence homology with metalloproteases from other bacterial species. N-terminal sequence analysis has shown that 23-27 of the first 42 amino acid residues of this metalloprotease are identical to proteases produced by Serratia proteamaculans, Pectobacterium carotovorum, and Anabaena sp. . This conservation suggests evolutionary relationships and potentially similar functional roles across these different bacterial species.

Unlike some bacterial metalloproteases that exhibit dual functionality, BMEI0829 does not demonstrate hemagglutinating activity against chicken or sheep erythrocytes . This distinguishes it from metalloproteases that function both as proteases and hemagglutinins.

The protein likely belongs to the M10 family of metalloproteases based on sequence characteristics, though definitive classification requires experimental confirmation through enzymatic assays and inhibitor studies. As with other zinc metalloproteases, BMEI0829 activity would be expected to be inhibited by metal chelators such as EDTA and o-phenanthroline, which disrupt the zinc-coordination essential for catalytic activity.

What are the optimal storage and handling conditions for recombinant BMEI0829?

For maximum stability and retained enzymatic activity, recombinant BMEI0829 should be stored in the following conditions:

  • Storage buffer: A Tris-based buffer containing 50% glycerol, specifically optimized for this protein .

  • Storage temperature: -20°C for regular storage; -20°C or -80°C for extended storage periods .

  • Working aliquots: Store at 4°C for up to one week to avoid repeated freeze-thaw cycles .

Researchers should be aware that repeated freezing and thawing is not recommended as this can lead to protein denaturation and loss of enzymatic activity . When handling the protein for experimental purposes, it is advisable to thaw aliquots on ice and maintain cold chain practices during experimental procedures.

To preserve enzymatic activity during experimental work, consider supplementing buffers with zinc ions (typically 1-10 μM ZnCl₂) as zinc metalloproteases require this metal cofactor for catalytic function. Additionally, avoid using metal chelators such as EDTA in buffers unless specifically testing inhibition properties.

What expression systems are most effective for producing recombinant BMEI0829?

The choice of expression system for BMEI0829 production depends on research objectives and downstream applications. Based on studies with similar recombinant proteins, the following approaches are recommended:

The E. coli expression system, particularly using BL21(DE3) strain with pET expression vectors (such as pET28a), has been successfully employed for recombinant protein production . This system offers several advantages, including high yield, ease of genetic manipulation, and well-established purification protocols.

Optimization parameters for E. coli-based expression include induction with 0.8 mM IPTG, cultivation under various conditions including simulated microgravity (SMG), and testing different induction temperatures (17°C, 27°C, or 37°C) and induction times (4, 6, or 8 hours) . Studies have shown that SMG conditions significantly enhance recombinant protein production through upregulation of ribosomal and RNA polymerase genes, improved energy metabolism, enhanced protein folding, and strengthened protein export mechanisms .

ParameterOptimization OptionsConsiderations
E. coli StrainBL21(DE3), Rosetta, OrigamiBL21(DE3) for high yield; Rosetta for rare codons
Vector SystempET28a, pET22b, pGEXTag selection affects purification strategy
Induction Temperature17°C, 27°C, 37°CLower temperatures may improve folding
IPTG Concentration0.1 mM, 0.5 mM, 0.8 mMHigher concentrations increase metabolic burden
Culture ConditionsNormal gravity, SMGSMG enhances protein production
MediaLB, 2×YT, TBRich media typically provide higher yields

What methodologies can be used to assess BMEI0829 enzymatic activity?

Characterizing the enzymatic activity of BMEI0829 requires multiple complementary approaches:

Substrate Hydrolysis Assays: Synthetic peptide substrates with fluorogenic or chromogenic leaving groups can be employed to monitor cleavage spectrophotometrically. For zinc metalloproteases, substrates coupled to reporter molecules like p-nitroaniline (pNA) or 7-amino-4-methylcoumarin (AMC) allow continuous monitoring of enzymatic activity through increased absorbance or fluorescence.

Inhibition Studies: The metalloprotease nature of BMEI0829 can be confirmed through inhibitor profiling using metal chelators (EDTA, o-phenanthroline), thiol-modifying agents (N-ethylmaleimide), and other protease inhibitors . A true zinc metalloprotease will show significant inhibition with metal chelators but not with serine or cysteine protease inhibitors.

Zymography: This technique involves incorporating potential protein substrates (e.g., casein, gelatin) into polyacrylamide gels. After electrophoresis and incubation, proteolytic activity appears as clear bands against a stained background, allowing visualization of active enzyme forms.

pH and Temperature Profiling: Determine optimal activity conditions by measuring enzymatic activity across pH ranges (typically pH 5.0-9.0) and temperatures (25-50°C) to establish the enzyme's stability and optimal working parameters.

Metal Ion Dependency: Assess activity in the presence of various metal ions (Zn²⁺, Ca²⁺, Mg²⁺, Mn²⁺) to confirm zinc dependency and identify any co-factors that enhance activity.

How can structural integrity of purified BMEI0829 be verified?

Multiple analytical techniques can be employed to verify the structural integrity of purified BMEI0829:

Circular Dichroism (CD) Spectroscopy: Far-UV CD (190-250 nm) provides information about secondary structure content (α-helices, β-sheets), while near-UV CD (250-350 nm) offers insights into tertiary structure. Comparing spectra with those of properly folded similar metalloproteases helps assess structural similarity.

Fluorescence Spectroscopy: Intrinsic tryptophan fluorescence is sensitive to the local environment of these residues and can indicate conformational changes or denaturation. Changes in emission maximum or intensity can reveal structural alterations.

Thermal Shift Assay: This technique monitors protein unfolding as a function of temperature using fluorescent dyes like SYPRO Orange. The melting temperature (Tm) provides a measure of protein stability and can be used to optimize buffer conditions.

Size Exclusion Chromatography coupled with Multi-Angle Light Scattering (SEC-MALS): This approach determines the absolute molecular weight and oligomeric state of the protein in solution, detecting aggregates or oligomers that may indicate improper folding.

Limited Proteolysis: Partial digestion with proteases like trypsin or chymotrypsin can be compared with a reference sample. Properly folded proteins typically show characteristic resistance patterns to proteolysis compared to misfolded variants.

Enzymatic Activity: The ultimate verification of structural integrity is functional activity. Enzymatic assays described in section 2.2 confirm that the protein is catalytically active, which requires proper folding of the active site.

What is the potential role of BMEI0829 in Brucella pathogenesis?

Understanding BMEI0829's function in Brucella pathogenesis requires examining its role in host-pathogen interactions. Based on studies of Brucella infection models and knowledge of similar bacterial metalloproteases, several potential functions can be proposed:

Brucella melitensis is a facultative intracellular pathogen that causes brucellosis, with the majority of human cases attributed to this species . During infection, B. melitensis must overcome host defenses to establish chronic infection. As a putative zinc metalloprotease, BMEI0829 may contribute to this process through several mechanisms:

Immune Evasion: BMEI0829 might degrade host defense proteins such as antibodies or complement components, helping Brucella evade immune clearance.

Cellular Invasion and Dissemination: The protease activity could facilitate modification of extracellular matrix or cell surface proteins, potentially aiding in bacterial invasion or movement between tissues.

Intracellular Survival: Studies show that B. melitensis can infect alveolar macrophages and exhibits a biphasic growth pattern characterized by initial killing followed by replication . BMEI0829 may play a role in adapting to the intracellular environment by processing bacterial or host proteins.

Virulence Regulation: Like other bacterial virulence factors, BMEI0829 expression may be regulated in response to environmental cues encountered during infection. Transposon sequencing (Tn-seq) analysis has identified genes required for B. melitensis survival in macrophages and in murine lungs , potentially including regulators of BMEI0829.

The dependence of B. melitensis on the Type IV Secretion System (T4SS) for survival in macrophages suggests possible interaction between this secretion system and virulence factors like BMEI0829, either through regulation or secretion mechanisms.

How can transcriptomic and proteomic approaches be integrated to study BMEI0829 function?

Integrating transcriptomic and proteomic approaches provides comprehensive insights into BMEI0829's expression, regulation, and function in various experimental contexts:

Transcriptomic Analysis (RNA-seq) can reveal expression levels of BMEI0829 under different conditions, identify co-regulated genes that may functionally interact with BMEI0829, and elucidate regulatory networks controlling its expression. When comparing wild-type and mutant strains, RNA-seq can identify genes whose expression is affected by BMEI0829 presence or absence.

Proteomic Analysis using mass spectrometry confirms translation of BMEI0829 mRNA into protein, identifies post-translational modifications affecting function, detects protein-protein interactions involving BMEI0829, and can identify potential substrates by comparing proteomes with and without active enzyme.

The power of integrating these approaches is demonstrated in studies of recombinant protein production under simulated microgravity (SMG), where both transcriptomic and proteomic analyses revealed upregulation of protein synthesis, folding, and export pathways . Similar integrated approaches can be applied to study BMEI0829 in contexts such as:

  • Comparing wild-type vs. BMEI0829 knockout strains

  • Analyzing expression during different infection stages

  • Examining responses to potential inhibitors

  • Identifying differential expression in resistant vs. permissive host cells

Research QuestionTranscriptomic ApproachProteomic ApproachIntegrated Analysis Benefit
When is BMEI0829 expressed?RNA-seq time courseTargeted MS detectionCorrelation of transcript and protein levels
What regulates BMEI0829?RNA-seq with regulatory mutantsPhosphoproteomicsNetwork analysis of regulators and targets
What are BMEI0829 targets?RNA-seq of knockout vs. WTComparative proteomicsPathway analysis of affected processes
How does BMEI0829 contribute to virulence?Transcriptional response to inhibitionSecretome analysisSystems-level modeling of virulence

What inhibitors could potentially target BMEI0829 and how should they be evaluated?

As a putative zinc metalloprotease, BMEI0829 is likely susceptible to several classes of inhibitors, which can be evaluated through systematic screening and characterization:

Metal Chelators: As a zinc-dependent enzyme, BMEI0829 would be inhibited by compounds that bind zinc, including EDTA (ethylenediaminetetraacetic acid), EGTA (ethylene glycol tetraacetic acid), and o-phenanthroline . These compounds can be used to confirm BMEI0829's classification as a zinc metalloprotease.

Specific Metalloprotease Inhibitors: Based on inhibitor profiles of similar metalloproteases, compounds such as phosphoramidon (inhibits thermolysin-like metalloproteases), galardin (GM6001, a broad-spectrum MMP inhibitor), marimastat, and batimastat could be tested. These studies would provide insights into BMEI0829's structural family and potential for therapeutic targeting.

Natural Products: Plant-derived compounds such as catechins, curcumin, or resveratrol have demonstrated inhibitory activity against various metalloproteases and could be screened against BMEI0829 as potential lead compounds for therapeutic development.

Synthetic Peptide Inhibitors: Based on substrate specificity studies, peptide analogs with modifications that confer inhibitory properties could be designed. Hydroxamate-based peptide mimetics are often effective against zinc metalloproteases.

Evaluation of these inhibitors should follow a systematic approach:

  • Initial screening using enzymatic assays to identify active compounds

  • Determination of IC50/Ki values for promising candidates

  • Selectivity testing against human metalloproteases

  • Evaluation of activity in cellular infection models

  • Assessment of pharmacokinetic properties and bioavailability

  • Testing in animal infection models for promising leads

These studies would not only characterize BMEI0829 biochemically but could also identify starting points for developing targeted therapeutics against Brucella infections.

How does the expression of BMEI0829 change during different stages of Brucella infection?

Understanding the dynamic expression of BMEI0829 during infection provides insights into its role in pathogenesis. Several approaches can be used to track expression changes:

Brucella melitensis undergoes significant adaptation during its infectious cycle, from initial entry to persistent infection. Studies of B. melitensis in murine lung infection models show that after intranasal infection, bacteria primarily infect alveolar macrophages . During the first 48 hours post-infection, the bacterial population undergoes a succession of killing and growth phases, followed by heterogeneous proliferation .

To study BMEI0829 expression during these stages, researchers can use:

In vivo Expression Technology: By creating transcriptional fusions between the BMEI0829 promoter and reporter genes (GFP, luciferase), expression can be monitored during infection.

Quantitative RT-PCR: This technique can measure BMEI0829 mRNA levels in bacteria recovered from infected cells or tissues at different time points.

RNA-seq: Transcriptome analysis of bacteria during infection can reveal BMEI0829 expression relative to the entire genome and identify co-regulated genes.

Immunodetection: Using antibodies against BMEI0829, protein levels can be assessed by techniques such as immunohistochemistry, flow cytometry, or Western blotting.

Single-Cell Analysis: Fluorescence microscopy of bacteria expressing reporter constructs can reveal heterogeneity in BMEI0829 expression at the individual cell level, similar to the heterogeneous proliferation observed in infection models .

Understanding expression patterns may reveal whether BMEI0829 is constitutively expressed or induced under specific conditions encountered during infection, such as nutrient limitation, oxidative stress, or exposure to host antimicrobial factors. This information is crucial for determining its role in pathogenesis and evaluating its potential as a therapeutic target.

How might BMEI0829 be evaluated as a potential vaccine antigen?

BMEI0829, as a bacterial protein potentially involved in virulence, presents several opportunities for vaccine development against Brucella melitensis:

Antigen Evaluation: Before considering BMEI0829 as a vaccine candidate, several characteristics should be evaluated:

  • Conservation across Brucella strains and species to ensure broad protection

  • Surface exposure or secretion, which enhances accessibility to the immune system

  • Immunogenicity in relevant animal models

  • Role in virulence to determine if neutralizing responses would impact pathogenesis

Vaccine Formulation Approaches: Several strategies could be employed to develop BMEI0829-based vaccines:

  • Recombinant protein subunit vaccines using purified BMEI0829 with appropriate adjuvants

  • DNA vaccines encoding BMEI0829

  • Viral vector vaccines expressing BMEI0829

  • Live attenuated Brucella strains with modified BMEI0829 expression

  • Multi-epitope vaccines incorporating immunodominant regions of BMEI0829 with other Brucella antigens

Immune Response Evaluation: Effective Brucella vaccines should induce both cell-mediated immunity (particularly Th1 responses) and humoral immunity. Evaluation of BMEI0829-based vaccines should include:

  • T cell activation and cytokine profiles (IFN-γ, IL-2, TNF-α)

  • Antibody production (titer, isotype, neutralizing capacity)

  • Protection in appropriate animal models

  • Duration of immunity

Vaccine ApproachAdvantagesChallengesEvaluation Methods
Recombinant ProteinDefined composition, SafetyAdjuvant requirementELISA, T cell assays, Challenge studies
DNA VaccineInduces cellular immunityLower immunogenicity in large animalsAntibody titers, IFN-γ ELISpot, Protection
Viral VectorStrong immune responsePre-existing vector immunityT cell polyfunctionality, Challenge studies
Live AttenuatedNatural immune responseSafety concernsBacterial burden, Histopathology, Protection

What methodological approaches should be used to investigate BMEI0829 as a drug target?

Investigating BMEI0829 as a drug target requires a systematic approach from target validation to inhibitor development:

Target Validation: Before investing in inhibitor development, researchers should:

  • Generate BMEI0829 knockout or conditional mutant strains

  • Assess the impact on bacterial growth in various conditions

  • Evaluate virulence in cellular and animal infection models

  • Determine whether BMEI0829 is essential for growth or virulence

  • Characterize enzymatic activity and substrate specificity

Structural Characterization:

  • Obtain crystal structure of BMEI0829 through X-ray crystallography or cryo-EM

  • Identify active site residues and potential allosteric sites

  • Compare with structures of similar enzymes with known inhibitors

  • Use structural information for rational inhibitor design

Inhibitor Development:

  • Develop high-throughput screening assays using fluorogenic or chromogenic substrates

  • Screen compound libraries (synthetic libraries, natural products)

  • Test known inhibitors of similar metalloproteases

  • Perform structure-activity relationship studies for promising compounds

  • Optimize lead compounds for potency, selectivity, and pharmacokinetic properties

Evaluation in Infection Models:

  • Test inhibitor efficacy in macrophage infection models

  • Assess activity against intracellular bacteria

  • Determine effectiveness in animal models of acute and chronic brucellosis

  • Evaluate combination therapy with standard antibiotics

Delivery Considerations: Since Brucella is an intracellular pathogen, inhibitors must reach the bacterial niche within cells. Strategies to enhance delivery include:

  • Nanoparticle formulations

  • Liposomal delivery

  • Cell-penetrating peptide conjugates

  • Prodrug approaches

This methodological pipeline enables researchers to progress from identifying BMEI0829 as a potential target to developing effective inhibitors with therapeutic potential.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.