Recombinant Brucella melitensis biotype 1 sn-glycerol-3-phosphate transport system permease protein ugpA (ugpA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this to us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. The shelf life of lyophilized forms is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
ugpA; BMEII0624; sn-glycerol-3-phosphate transport system permease protein UgpA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)
Target Names
ugpA
Target Protein Sequence
MQKVTFPNKILPYFLLAPQIVLTVVFFFWPASQAIYQSFMMREDAFGLKSTFVELANFTA VLSDPNYLHSVQVTVVFNVLTALLAMGVALLLATAADRVIRGQTFYRTLLIWPYAVAPAV AGMLWLFMFNPAMGTFAYLLRRNGIAWDPLLDGNQAMGLVVVAAAWKQISYNFLFFVAGL QAIPKSLIEAAAIDGARGARRFWTIVFPLLAPTSFFLLVVNTVYAFFDTFGIIHAVTGGG PAKATETLVYNDGFVNLNLGSSSAQSVILMAIVIALTAFQFRFVEKRVHYS
Uniprot No.

Target Background

Function
This protein is part of the ABC transporter complex UgpABCE, involved in sn-glycerol-3-phosphate import. It is likely responsible for the translocation of the substrate across the membrane.
Database Links
Protein Families
Binding-protein-dependent transport system permease family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is ugpA and what role does it play in Brucella melitensis?

The ugpA protein is a component of the sn-glycerol-3-phosphate (G3P) transport system in Brucella melitensis. It functions as a permease protein, forming part of the membrane-spanning complex that facilitates the movement of G3P across the bacterial cell membrane. This transport system belongs to the binding protein-dependent transport systems, which are typically composed of a periplasmic binding protein, membrane-spanning proteins (like ugpA), and an ATP-binding protein that provides energy for transport .

Similar to what has been observed in E. coli, the ugp-dependent transport system is likely induced under conditions of phosphate starvation in Brucella species . In bacterial pathogens, nutrient acquisition systems like ugpA play crucial roles in survival within host environments where nutrients may be limited.

How does the ugpA protein function within the bacterial membrane transport system?

The ugpA protein serves as a transmembrane component of the G3P transport system, creating a channel through which the substrate can pass. In binding protein-dependent transport systems like ugp, the process typically begins with a periplasmic binding protein capturing the substrate (in this case, sn-glycerol-3-phosphate) in the periplasmic space. This substrate-binding protein complex then interacts with membrane components including ugpA, triggering conformational changes that allow the substrate to be translocated across the membrane .

Research in E. coli has shown that the membrane components alone are insufficient for transport activity - the periplasmic binding protein is necessary but not sufficient for complete functionality of the transport system . This highlights the complex, multi-component nature of these transport systems, where ugpA functions as part of a larger molecular machine.

What is the genetic organization of the ugp operon in Brucella melitensis?

The ugp operon in Brucella melitensis likely shares similarities with that of other bacteria like E. coli, though with species-specific variations. In typical bacterial arrangements, the ugp operon contains genes encoding the periplasmic binding protein, membrane components (including ugpA), and ATP-binding proteins that power the transport.

The genetic regulation of the ugp system in Brucella may involve phosphate regulation networks, as seen in E. coli where the ugp transport system is part of the pho regulon and is induced under phosphate-limiting conditions . This regulatory mechanism allows bacteria to optimize their phosphate uptake systems based on environmental availability.

What methods are most effective for studying ugpA expression in Brucella melitensis?

Studying ugpA expression in Brucella melitensis requires a combination of molecular biology techniques:

  • Quantitative RT-PCR: This technique allows precise measurement of ugpA transcript levels under different conditions, such as phosphate limitation or during infection.

  • Reporter Gene Fusion: Constructing fusions between the ugpA promoter and reporter genes such as lacZ or GFP can help visualize expression patterns in different environments.

  • RNA-Seq: This approach provides comprehensive transcriptomic data, allowing researchers to understand ugpA expression in the context of global gene expression changes.

  • Western Blotting: Using antibodies specific to ugpA enables detection and quantification of protein levels, complementing transcriptional analysis.

  • Proteomics: Mass spectrometry-based approaches can identify and quantify ugpA protein abundance in different growth conditions.

When designing experiments to study ugpA expression, it's important to consider that, like in E. coli, expression might be induced under phosphate starvation conditions or in specific host environments . Therefore, experimental designs should include appropriate control conditions and physiologically relevant stress factors.

What purification strategies are recommended for recombinant ugpA protein?

Purifying recombinant ugpA presents significant challenges due to its nature as a membrane protein. Recommended strategies include:

Table 1: Purification Strategies for Recombinant ugpA Protein

StrategyMethodologyAdvantagesLimitations
Detergent SolubilizationMembrane disruption with mild detergents (DDM, LDAO)Maintains protein structureDetergent may interfere with downstream applications
Affinity ChromatographyHis-tag or other fusion tagsHigh specificityTags may affect protein function
Size ExclusionSeparation based on molecular sizeGood for final polishingLimited loading capacity
Styrene Maleic Acid Lipid Particles (SMALPs)Extraction with SMA copolymersPreserves native lipid environmentRelatively new technique

How can researchers generate antibodies against ugpA for immunological studies?

Generating effective antibodies against membrane proteins like ugpA requires careful consideration of antigenic regions and purification approaches:

  • Peptide Antibodies: Design peptides corresponding to predicted extracellular or periplasmic loops of ugpA that are likely to be antigenic and accessible.

  • Recombinant Fragment Approach: Express soluble fragments of ugpA containing hydrophilic domains for immunization.

  • Whole Protein Approach: Use purified full-length ugpA in detergent micelles or nanodiscs for immunization.

  • DNA Immunization: Utilize plasmid DNA encoding ugpA for in vivo expression and antibody generation.

When validating antibodies, it's essential to include appropriate controls, including samples from ugpA deletion mutants of Brucella melitensis. Western blotting, immunofluorescence, and immunoprecipitation can be used to confirm antibody specificity and determine appropriate working dilutions.

How does phosphate starvation affect ugpA expression and function?

Based on knowledge from similar transport systems in other bacteria, ugpA expression in Brucella melitensis is likely regulated by phosphate availability. In E. coli, the ugp transport system is induced under conditions of phosphate starvation and is part of the pho regulon . A similar pattern might exist in Brucella, where limited phosphate availability would trigger increased expression of ugpA and other components of the G3P transport system.

Researchers investigating this relationship should design experiments that:

  • Compare ugpA expression under phosphate-rich and phosphate-limited conditions

  • Examine the role of potential regulatory proteins (like PhoB/PhoR two-component system)

  • Determine if phosphate limitation affects the composition or function of the ugp transport complex

The fourth search result indicates that in E. coli, "the ugp-dependent transport system for sn-glycerol-3-phosphate has been characterized. The system is induced under conditions of phosphate starvation and in mutants that are constitutive for the pho regulon." Similar regulatory mechanisms may exist in Brucella melitensis.

What role might ugpA play in Brucella melitensis virulence and host adaptation?

The ugpA protein may contribute to Brucella melitensis virulence through several potential mechanisms:

  • Nutrient Acquisition: By facilitating G3P uptake, ugpA could help Brucella obtain carbon and phosphate sources within nutrient-limited host environments.

  • Membrane Phospholipid Synthesis: G3P is a precursor for phospholipid biosynthesis, which is essential for membrane integrity and adaptation to host environments.

  • Stress Response: The ability to acquire phosphate efficiently through the ugp system might contribute to bacterial survival under stress conditions encountered during infection.

  • Intracellular Survival: Brucella species are known for their ability to survive within host cells. The ugp system might support this intracellular lifestyle by ensuring access to necessary nutrients.

Studies in Brucella melitensis have demonstrated its ability to disseminate widely in infected hosts, with extensive tissue colonization observed in experimental infections . Transport systems that facilitate nutrient acquisition are likely important for this successful colonization of diverse host tissues.

How does ugpA function compare between Brucella melitensis and other bacterial species?

While the specific characteristics of ugpA in Brucella melitensis may have unique features, some functional comparisons can be made with better-studied systems like E. coli:

  • Transport Mechanism: In E. coli, the ugp system is a binding protein-dependent transport system, requiring a periplasmic binding protein for activity . This is likely similar in Brucella, although species-specific variations in protein structure and efficiency may exist.

  • Regulation: The E. coli ugp system is induced under phosphate starvation and is part of the pho regulon . Brucella melitensis may share this regulatory pattern, but might also have additional regulatory mechanisms related to its pathogenic lifestyle.

  • Role in Metabolism: In E. coli, G3P transported via the ugp system can be incorporated into phospholipids and other cellular components when an alternate carbon source is available . Similar metabolic integration likely occurs in Brucella.

Table 2: Comparison of ugp System Features Between Bacterial Species

FeatureE. coli ugp SystemPredicted Brucella melitensis ugp System
Transport ComponentsPeriplasmic binding protein, membrane components (including ugpA), ATP-binding proteinLikely similar components with sequence variations
InductionPhosphate starvation, pho regulonLikely phosphate-responsive; may have additional regulatory mechanisms
Metabolism of G3PUsed for phospholipid synthesis; requires alternate carbon sourceLikely similar with potential adaptations for intracellular lifestyle
Substrate Specificitysn-glycerol-3-phosphatePresumed similar; potential for broader substrate range

What methodologies can be used to study structure-function relationships of ugpA?

Investigating structure-function relationships of ugpA requires specialized techniques for membrane protein analysis:

  • Cryo-Electron Microscopy: Can reveal the three-dimensional structure of the entire ugp transport complex, including ugpA within its native membrane environment.

  • Substituted Cysteine Accessibility Method (SCAM): By introducing cysteine residues at various positions and testing their accessibility to thiol-reactive reagents, researchers can map topology and identify functionally important regions.

  • Cross-linking Studies: Chemical cross-linking combined with mass spectrometry can identify interaction partners and conformational changes during the transport cycle.

  • Molecular Dynamics Simulations: Computational approaches can model ugpA within a lipid bilayer and simulate substrate transport mechanisms.

  • Site-Directed Mutagenesis: Systematic mutation of conserved residues can identify amino acids critical for substrate recognition, transport, or protein-protein interactions.

When designing structure-function studies, researchers should consider the multi-component nature of binding protein-dependent transport systems, where periplasmic binding proteins interact with membrane components like ugpA to facilitate transport .

How can CRISPR-Cas9 techniques be applied to modify ugpA expression or function?

CRISPR-Cas9 technology offers powerful approaches for studying ugpA in Brucella melitensis:

  • Gene Knockout: Complete deletion of ugpA to assess its role in growth, survival, and virulence.

  • Point Mutations: Introduction of specific mutations to study the importance of conserved residues or domains.

  • Promoter Modifications: Alterations to regulatory regions to study expression control.

  • Tagging Approaches: Addition of epitope or fluorescent tags for visualization and tracking.

  • CRISPRi/CRISPRa: CRISPR interference or activation systems for conditional repression or enhancement of ugpA expression.

When applying CRISPR-Cas9 in Brucella melitensis, researchers must consider:

  • Appropriate delivery methods for CRISPR components into this intracellular pathogen

  • Potential polar effects on downstream genes in the ugp operon

  • Selection markers compatible with Brucella genetics

  • Validation approaches to confirm the desired genetic modifications

What approaches can resolve contradictory findings regarding ugpA function or expression?

Researchers investigating ugpA may encounter contradictory results due to experimental variables or biological complexity. Resolving such contradictions requires:

  • Standardized Experimental Conditions: Ensure comparable growth conditions, particularly regarding phosphate availability, which is known to affect ugp system expression .

  • Strain Verification: Confirm the genetic background of Brucella strains, as different isolates may exhibit variation in genetic sequences or regulation .

  • Multi-Method Validation: Use complementary techniques to assess ugpA function and expression, such as combining transcriptional analysis with protein detection and transport assays.

  • In Vitro vs. In Vivo Comparisons: Behavior in laboratory media may differ from conditions within host cells. Testing ugpA function in multiple contexts can reconcile apparent contradictions.

  • Genetic Complementation: Reintroducing wild-type ugpA into mutant strains can confirm phenotypic changes are specifically due to ugpA alterations.

The research on antimicrobial resistance genes in Brucella melitensis has shown that "mere presence of genes does not confirm antimicrobial resistance," highlighting the importance of functional validation beyond simple presence/absence studies.

How might ugpA contribute to antimicrobial resistance mechanisms in Brucella melitensis?

While not directly identified as an antimicrobial resistance determinant, ugpA may indirectly contribute to resistance mechanisms in Brucella melitensis:

  • Phosphate Acquisition: By facilitating G3P uptake, ugpA may help maintain phosphate levels needed for cellular processes during antimicrobial stress.

  • Membrane Composition: G3P is a precursor for phospholipid synthesis, which affects membrane permeability and potentially the entry of antimicrobial agents.

  • Metabolic Adaptation: Enhanced nutrient uptake systems may support metabolic shifts that occur during antimicrobial exposure.

  • Interaction with Efflux Systems: Transport systems may indirectly affect the function of efflux pumps, which are known contributors to antimicrobial resistance in Brucella.

Research on Brucella melitensis has identified several efflux pump components, including "the multiple peptide resistance factor (Brucella_suis_mprF) protein and RND-family efflux genes (bepC, bepD, bepE, bepF, and bepG)," which play roles in antimicrobial resistance. While not directly linked, the ugp system may interact with these resistance mechanisms in complex ways.

What ethical considerations should researchers address when working with recombinant Brucella melitensis proteins?

Research involving Brucella melitensis components requires careful ethical considerations:

  • Biosafety Concerns: Brucella melitensis is a Risk Group 3 pathogen and zoonotic agent that can cause serious human disease (brucellosis). All work with viable organisms or potentially infectious components must be conducted in appropriate containment facilities .

  • Dual-Use Research Potential: Research on bacterial transport systems could theoretically be misused. Researchers should be mindful of dual-use concerns and follow institutional and national guidelines.

  • Animal Research Ethics: Studies involving animal models of brucellosis must adhere to animal welfare guidelines and employ the 3Rs principle (Replacement, Reduction, Refinement) .

  • Transparent Reporting: Methodologies should be comprehensively reported to allow proper risk assessment and reproducibility.

  • International Collaboration Considerations: Research teams spanning multiple countries must navigate varying regulatory frameworks regarding select agent research.

The potential for serious disease is highlighted by research showing that "infection of goats with B. melitensis 16M resulted in an 86% abortion rate" , underscoring the importance of strict biosafety measures when working with this pathogen or its components.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.