Recombinant Brucella melitensis biotype 1 Type IV secretion system protein virB3 (virB3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
virB3; BMEII0027; Type IV secretion system protein virB3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-116
Protein Length
full length protein
Species
Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)
Target Names
virB3
Target Protein Sequence
MTTAPQESNARSAGYRGDPIFKGCTRPAMLFGVPVIPLVIVGGSIVLLSVWISMFILPLI VPIVLVMRQITQTDDQMFRLLGLKAQFRLIHFNRTGRFWRASAYSPIAFTKRKRES
Uniprot No.

Target Background

Database Links
Protein Families
VirB3 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural characterization of VirB3 protein in Brucella melitensis?

VirB3 from Brucella is a membrane-associated protein that forms part of the Type IV Secretion System (T4SS). Structurally, VirB3 proteins are predicted to be bitopic or polytopic membrane proteins with one or two transmembrane helices located within the region encompassed by residues 15 and 57 . This membrane topology is consistent with the difficulty in defining VirB3 topology in other T4SSs. The protein maintains highly conserved synteny with the virB4 gene, suggesting potential protein-protein interactions at or within the inner membrane .

What is the role of VirB3 in the Type IV Secretion System of Brucella melitensis?

VirB3 is an essential component of the Brucella T4SS, which functions as a crucial virulence factor enabling bacterial survival within host cells. The T4SS in Brucella is composed of 12 protein complexes (VirB1 to VirB12), with VirB3 playing a critical structural role . This secretion system allows Brucella to transfer effector molecules to host cells, modifying the intracellular environment to favor bacterial survival and replication.

Studies using nonpolar gene deletions have demonstrated that VirB3 is essential for the ability of Brucella to survive in macrophages and persist in the spleens of mice . Unlike VirB7 and VirB12, which appear dispensable for certain virulence traits, VirB3 deletion markedly reduces virulence, highlighting its fundamental importance to T4SS function .

How does VirB3 expression and localization occur in Brucella cells?

VirB3 exhibits a distinctive subcellular localization pattern in bacterial cells. Immunofluorescence microscopy studies have shown that VirB3 predominantly localizes to one cell pole, with approximately 88% of VirB3 foci found at cell poles . Notably, VirB3 can target itself to a cell pole independent of other VirB proteins, suggesting it possesses intrinsic polar localization signals .

The table below summarizes the localization data for VirB3 compared to other VirB proteins:

Probe antibodiesNo. of foci (no. of cells)No. of foci at a polePercent polar fociNo. of cells with polar fociNo. of cells with foci at one polePercent unipolar
VirB3243 (200)2138817714582

This polar localization is significant as it indicates that the cell pole is likely the site of T4SS apparatus assembly in Brucella .

What experimental approaches are most effective for studying VirB3 function in Brucella melitensis biotype 1?

Several complementary experimental approaches are recommended for comprehensive analysis of VirB3 function:

  • Genetic manipulation: Creating nonpolar deletion mutants of virB3 followed by functional complementation provides direct evidence of protein function. Studies have successfully employed two-step processes for constructing these mutants, amplifying up- and downstream fragments of the gene and ligating them together in cloning vectors .

  • Cellular assays: Macrophage infection assays using J774A.1 cells provide a standardized method for assessing the contribution of VirB3 to intracellular survival. This approach has demonstrated that VirB3 deletion reduces the ability of Brucella to survive in macrophages to a degree similar to deletion of the entire virB locus .

  • Animal models: Mouse infection models allow for assessment of virulence and persistence in vivo. Previous studies have shown that VirB3 is essential for persistence in the spleens of mice at 8 weeks post-infection .

  • Immunofluorescence microscopy: This technique effectively examines the subcellular localization of VirB3 and its interactions with other T4SS components. Studies have shown that 88% of VirB3 foci localize to the cell pole .

  • Protein-protein interaction studies: Co-immunoprecipitation and bacterial two-hybrid systems can help identify interaction partners of VirB3, particularly its proposed interaction with VirB4 .

How should researchers design experiments to express and purify recombinant VirB3 from Brucella melitensis biotype 1?

Expression and purification of recombinant VirB3 presents challenges due to its membrane-associated nature. A methodological approach should include:

  • Vector selection: pET expression vectors have been successfully used for recombinant VirB protein expression. Include affinity tags (His6 or GST) at either N- or C-terminus, avoiding disruption of transmembrane domains .

  • Expression system optimization: E. coli BL21(DE3) or Rosetta strains are recommended expression hosts. Consider induction at lower temperatures (16-20°C) to increase solubility of membrane proteins. IPTG concentrations between 0.1-0.5 mM are typically effective .

  • Solubilization strategies: Due to VirB3's membrane association, detergent screening is crucial. Try mild detergents like n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) for solubilization .

  • Purification protocol:

    • Employ immobilized metal affinity chromatography (IMAC) for His-tagged proteins

    • Include detergent in all purification buffers

    • Consider size exclusion chromatography as a polishing step

    • Validate protein identity by Western blotting and mass spectrometry

  • Quality control: Assess protein purity by SDS-PAGE and functional integrity through structural studies (CD spectroscopy) and interaction assays with known binding partners such as VirB4 .

What are the critical considerations for designing ELISA assays using recombinant VirB3 for brucellosis diagnosis?

When developing ELISA assays using recombinant VirB3 for brucellosis diagnosis, researchers should address several critical factors:

  • Antigen preparation: Ensure recombinant VirB3 maintains native epitopes through proper folding and post-translational modifications. Consider using bacterial expression systems that can produce properly folded membrane proteins .

  • Assay optimization:

    • Determine optimal coating concentration (typically 1-5 μg/ml)

    • Optimize blocking agents to minimize background

    • Establish appropriate serum dilutions (1:100 to 1:400 range)

    • Select optimal detection antibodies and substrates for maximal signal-to-noise ratio

  • Validation parameters: Recent studies with VirB proteins showed sensitivity and specificity exceeding 0.9100 and 0.9167 respectively, providing benchmarks for assay performance . Cross-reactivity with sera from febrile patients without brucellosis should be systematically evaluated using samples from patients with conditions that might produce similar symptoms.

  • Comparative analysis: Compare performance with established antigens like LPS and Rose Bengal Ag to contextualize diagnostic value. Include these antigens as reference standards in validation studies .

  • Statistical considerations: Calculate cutoff values using ROC curve analysis with well-characterized positive and negative control samples. Include confidence intervals for sensitivity and specificity metrics.

How does the virulence function of VirB3 compare between different Brucella melitensis biotypes?

While most published research has focused on Brucella melitensis biotype 3 (which is the most prevalent in clinical isolates, representing 39 out of 41 strains in one study ), comparative studies of T4SS function across biotypes remain limited.

When comparing virulence functions across biotypes, researchers should consider:

  • Sequence conservation: Analyze sequence homology of VirB3 across Brucella melitensis biotypes 1, 2, and 3. Although minor nucleotide substitutions have been observed in other Brucella proteins between biotypes, these often don't modify the amino acid sequence, suggesting functional conservation .

  • Expression levels: Quantitative proteomics approaches like TMT (Tandem Mass Tag) technology can identify differential expression of VirB3 across biotypes. This approach has successfully identified highly expressed VirB proteins in wild-type Brucella strains .

  • Virulence in cellular models: Comparative infection studies with macrophage cell lines can reveal biotype-specific differences in intracellular survival that may correlate with VirB3 function.

  • Host specificity: Consider whether biotype differences in VirB3 might contribute to the observed host preference patterns seen in different Brucella isolates. This would require well-controlled animal infection studies with multiple biotypes.

What is the potential of VirB3 as a diagnostic antigen for human brucellosis compared to other VirB proteins?

Recent research has demonstrated the diagnostic potential of VirB proteins, including VirB3, as novel antigens for human brucellosis detection. In comparative evaluations:

  • Diagnostic performance: VirB3 shows promising diagnostic metrics with sensitivity and specificity exceeding 0.9100 and 0.9167, respectively, comparable to traditional LPS and Rose Bengal Ag antigens .

  • Comparative effectiveness: Among seven T4SS proteins evaluated (rVirB3, rVirB4, rVirB9, rBMEII0036, rVirB8, rVirB11, and rVirB10), rVirB3 demonstrated excellent specificity, while rVirB4 and rVirB9 showed the highest sensitivity in indirect ELISA methods .

  • Cross-reactivity profile: VirB3 exhibits limited cross-reactivity with serum from febrile patients without brucellosis. In comparison, rVirB10 showed no cross-reactivity in 40 serum samples from febrile patients without brucellosis, indicating very high specificity .

  • Diagnostic applications: As components of the Brucella T4SS, VirB proteins like VirB3 may more directly reflect the infection status compared to conventional antigens, offering improved diagnostic accuracy, particularly in challenging cases .

What experimental design would be most appropriate for evaluating VirB3 function across different Brucella strains?

To rigorously evaluate VirB3 function across different Brucella strains, a factorial design experiment would be most appropriate. This allows for systematic analysis of multiple variables and their interactions :

  • Design structure: Implement a factorial design with the following factors:

    • Brucella species/strains (B. melitensis biotypes 1, 2, and 3)

    • VirB3 variants (wild-type, deletion mutant, complemented strain)

    • Experimental conditions (pH, temperature, stress conditions)

  • Control groups: Include appropriate controls such as:

    • Complete virB operon deletion mutants

    • Single gene deletions of other virB genes for comparison

    • Non-pathogenic Brucella strains

  • Outcome measures: Evaluate multiple endpoints:

    • Intracellular survival in different cell types

    • Protein-protein interactions within the T4SS complex

    • Subcellular localization patterns

    • In vivo persistence in animal models

  • Statistical analysis: Apply mixed-effects models to account for both fixed effects (strain, mutation status) and random effects (experimental batches). Use ANOVA for factorial analysis followed by post-hoc tests with appropriate correction for multiple comparisons .

This experimental design allows for robust analysis of VirB3 function across different biological contexts while controlling for confounding variables.

How can researchers address the challenges of measuring protein-protein interactions involving VirB3 in the Type IV Secretion System?

Studying protein-protein interactions (PPIs) involving membrane proteins like VirB3 presents unique challenges. A comprehensive approach should include:

  • In vivo crosslinking: Chemical crosslinking coupled with mass spectrometry can capture transient interactions within the native membrane environment. This approach has successfully identified interactions within T4SS complexes .

  • Bacterial two-hybrid systems: Modified bacterial two-hybrid systems that accommodate membrane proteins can detect direct interactions between VirB3 and other T4SS components.

  • Co-immunoprecipitation studies: Using mild detergent solubilization followed by co-immunoprecipitation with specific antibodies can pull down intact protein complexes containing VirB3. This has been effective for studying VirB protein interactions .

  • Förster resonance energy transfer (FRET): Fluorescent protein fusions with VirB3 and potential interaction partners can enable live-cell measurement of protein proximity and interactions, though care must be taken to ensure tags don't disrupt membrane topology.

  • Cryo-electron tomography: This technique has successfully visualized T4SS structures in situ and can provide structural evidence of VirB3's interactions within the assembled complex .

  • Validation strategies: Confirm interactions through multiple independent methods and use negative controls (unrelated membrane proteins) to ensure specificity. Functional validation through complementation studies with interaction-deficient mutants provides the strongest evidence of biological relevance.

What are the key considerations for analyzing data from immunological studies using recombinant VirB3 proteins?

When analyzing immunological data from studies using recombinant VirB3 proteins, researchers should address these critical considerations:

  • Antigen quality assessment: Validate recombinant VirB3 protein quality through:

    • SDS-PAGE and Western blot to confirm size and immunoreactivity

    • Mass spectrometry to verify sequence

    • Circular dichroism to assess secondary structure integrity

  • Background and cross-reactivity: Evaluate potential cross-reactivity with:

    • Other bacterial antigens, particularly from organisms causing febrile illnesses

    • Host proteins to identify potential autoimmune responses

    • Other VirB proteins to ensure specificity within the T4SS

  • Statistical analysis approaches:

    • Establish appropriate cutoff values through ROC curve analysis

    • Apply nonparametric tests for non-normally distributed antibody titers

    • Consider paired analyses for before/after vaccination or infection studies

    • Account for multiple comparisons when testing multiple antigens simultaneously

  • Data interpretation considerations:

    • Contextualize results within the known immunodominant epitopes of VirB proteins

    • Consider timing of sample collection relative to infection stage

    • Account for previous exposure history and vaccination status

    • Evaluate correlation between antibody responses and protection or bacterial clearance

  • Longitudinal analysis: Consider how antibody responses to VirB3 evolve over time during infection, which may differ from responses to conventional antigens like LPS, potentially providing complementary diagnostic information at different disease stages .

What are the most promising research directions for understanding the molecular mechanisms of VirB3 function in Brucella melitensis?

Several promising research directions could advance understanding of VirB3 function:

  • Structural biology approaches: Determining the high-resolution structure of VirB3 within the assembled T4SS complex would provide crucial insights into its function. Cryo-electron microscopy of intact T4SS complexes has proven valuable for related systems and could be applied to Brucella.

  • Protein dynamics studies: Investigating how VirB3 dynamics change during substrate translocation through the T4SS using techniques like hydrogen-deuterium exchange mass spectrometry would reveal functional mechanisms.

  • Interaction mapping: Comprehensive mapping of VirB3's interactome throughout the infection cycle would clarify its role in T4SS assembly and function. Quantitative proteomics approaches like BioID or APEX proximity labeling could identify transient interaction partners .

  • Single-molecule studies: Applying single-molecule tracking to fluorescently labeled VirB3 in live bacteria could reveal dynamics of T4SS assembly and the recruitment of VirB3 to the cell pole .

  • Substrate tracking: Developing methods to visualize the translocation of T4SS substrates in relation to VirB3 localization would clarify its role in the secretion process. This could involve fluorescently tagged effector proteins and super-resolution microscopy.

These approaches would collectively provide mechanistic insights into how VirB3 contributes to T4SS function and Brucella virulence.

How might advances in structural biology techniques impact our understanding of VirB3 in the context of the T4SS complex?

Recent advances in structural biology offer transformative potential for understanding VirB3 function:

  • Cryo-electron tomography: This technique has recently revealed T4SS structures in their native context, showing significant differences between in situ and in vitro structures . Applied to VirB3, it could reveal how this protein integrates into the T4SS machinery and interacts with other components like VirB4.

  • Integrative structural biology: Combining multiple techniques (X-ray crystallography, NMR, cryo-EM, crosslinking mass spectrometry) could overcome challenges posed by VirB3's membrane association and build comprehensive models of its structure and interactions.

  • Structural dynamics: Time-resolved structural methods could capture conformational changes in VirB3 during different stages of T4SS assembly and function, particularly in response to substrate engagement or ATP hydrolysis by associated ATPases .

  • In-cell structural biology: Emerging techniques for studying protein structures within living cells could reveal how the native cellular environment influences VirB3 conformation and interactions.

  • Machine learning applications: AI-based structure prediction tools like AlphaFold2 could provide insights into VirB3 structure and guide experimental approaches, particularly for regions that are challenging to resolve experimentally.

These advances would help resolve long-standing questions about T4SS architecture and mechanism, including how the inner membrane components like VirB3 connect to the outer membrane complex and participate in substrate translocation.

What are the broader implications of VirB3 research for understanding bacterial pathogenesis and developing intervention strategies?

Research on VirB3 has significant implications that extend beyond Brucella pathogenesis:

  • Evolutionary insights: Comparative analysis of VirB3 across different bacterial species reveals evolutionary relationships between T4SS systems and may identify conserved functional domains that represent fundamental aspects of secretion system biology .

  • Therapeutic targeting: As an essential component of the T4SS virulence machinery, VirB3 represents a potential target for novel antimicrobial strategies. Inhibitors that disrupt VirB3 function or its interactions could impair T4SS assembly and function, reducing bacterial virulence without directly killing bacteria, potentially reducing selection pressure for resistance .

  • Vaccine development: Understanding the immunogenicity of VirB3 could inform subunit vaccine design. T4SS proteins have shown promise as vaccine candidates, and VirB3's essential role in virulence makes it a logical component to include in vaccine formulations .

  • Diagnostic applications: VirB3's demonstrated potential as a diagnostic antigen with high sensitivity and specificity contributes to improved brucellosis diagnosis. This could be particularly valuable in resource-limited settings where current diagnostic methods are suboptimal .

  • Fundamental cell biology: Studies of VirB3's polar localization contribute to our understanding of bacterial cell polarity and protein targeting mechanisms. The ability of VirB3 to self-localize to the cell pole independent of other VirB proteins suggests intrinsic targeting signals that could inform broader principles of bacterial protein localization .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.