Recombinant Brucella melitensis biotype 1 UPF0283 membrane protein BMEI0952 (BMEI0952)

What is Brucella melitensis biotype 1 UPF0283 membrane protein BMEI0952?

BMEI0952 is a membrane protein from Brucella melitensis biotype 1, classified as part of the UPF0283 protein family. It is a full-length protein consisting of 357 amino acids and functions as an integral membrane component. The protein plays a potential role in the pathogen's membrane integrity and may contribute to antimicrobial resistance mechanisms. Studies of Brucella melitensis have identified this protein within the context of the bacterium's genome, which has been expanded to include 12 recognized species since its initial discovery in 1887 by Sir David Bruce . For research purposes, the recombinant version is typically expressed with an N-terminal His tag in E. coli expression systems to facilitate purification and subsequent functional studies .

What are the structural characteristics of the BMEI0952 protein?

The BMEI0952 protein is a membrane-associated protein with the following structural features:

• Protein length: 357 amino acids (full-length)

• Membrane localization: Integral membrane protein

• Modifications for research: Typically expressed with an N-terminal His tag

• UniProt ID: Q8YH52

A detailed examination of the amino acid sequence reveals hydrophobic regions consistent with transmembrane domains, which is characteristic of membrane proteins. The sequence contains multiple charged residues at the N-terminus, followed by hydrophobic stretches likely embedded within the membrane bilayer . Structural analysis suggests potential interaction sites with antimicrobial compounds, though crystallographic studies would be needed to confirm specific binding domains.

How should recombinant BMEI0952 protein be handled in laboratory settings?

Based on established protocols for recombinant membrane proteins, BMEI0952 requires specific handling techniques:

• Storage conditions: Store at -20°C/-80°C upon receipt with proper aliquoting for multiple uses

• Reconstitution method: Briefly centrifuge the vial before opening and reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Long-term storage: Add glycerol to a final concentration of 5-50% (optimal at 50%) and aliquot for storage at -20°C/-80°C

• Short-term working solution: Store working aliquots at 4°C for up to one week

• Stability considerations: Avoid repeated freeze-thaw cycles as this can compromise protein integrity

The protein is typically supplied as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE. For buffer conditions, a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 is recommended to maintain protein stability .

What experimental designs are most effective for studying BMEI0952 function?

When investigating BMEI0952 function, researchers should apply rigorous experimental design principles:

• Variable identification:

  • Independent variables: Expression levels, environmental conditions, antimicrobial agents

  • Dependent variables: Membrane integrity, bacterial viability, protein-protein interactions

  • Control variables: Growth conditions, bacterial strain background, expression system parameters

• Experimental approaches:

  • Comparative expression analysis under different stress conditions

  • Site-directed mutagenesis to identify functional domains

  • Protein-protein interaction studies using pull-down assays or bacterial two-hybrid systems

  • Antimicrobial susceptibility testing with and without BMEI0952 expression

• Controls and validation:

  • Inclusion of isogenic control strains (wild-type, deletion mutant, complemented strain)

  • Technical replicates (minimum triplicate) and biological replicates (3-5 independent experiments)

  • Statistical validation using appropriate tests (ANOVA, t-test) based on data distribution

The experimental design should systematically manipulate variables while controlling for extraneous factors. For instance, when testing the role of BMEI0952 in antimicrobial resistance, researchers should use concentration gradients of antibiotics and measure multiple parameters (e.g., MIC values, growth curves, membrane permeability) to establish comprehensive functional relationships .

How does BMEI0952 potentially contribute to antimicrobial resistance mechanisms?

The contribution of BMEI0952 to antimicrobial resistance likely involves complex membrane-associated mechanisms:

• Potential resistance mechanisms:

  • Membrane permeability modulation

  • Interaction with efflux pump systems

  • Structural alterations that reduce antibiotic binding

  • Participation in stress response pathways

Recent studies on B. melitensis antimicrobial resistance have revealed that resistance mechanisms are often multifactorial and cannot be attributed to single genes. For example, the consistent presence of certain AMR genes, including RND-family efflux genes (bepC, bepD, bepE, bepF, and bepG), was observed across multiple isolates without necessarily correlating with phenotypic resistance .

Membrane proteins like BMEI0952 may work in conjunction with these systems, potentially forming complexes or modulating membrane integrity. Researchers should design studies that examine BMEI0952 in the context of these known resistance mechanisms, possibly through co-immunoprecipitation or protein crosslinking experiments followed by mass spectrometry analysis.

What methodology should be employed for analyzing protein-protein interactions of BMEI0952?

To effectively study BMEI0952 interactions with other proteins, researchers should consider:

• In vitro approaches:

  • Pull-down assays using His-tagged BMEI0952 as bait

  • Surface plasmon resonance to measure binding kinetics

  • Far-Western blotting to detect specific interactions

  • Isothermal titration calorimetry for thermodynamic analysis

• In vivo approaches:

  • Bacterial two-hybrid systems adapted for membrane proteins

  • Förster resonance energy transfer (FRET) with fluorescently labeled proteins

  • Co-immunoprecipitation from Brucella cell lysates

  • Proximity labeling techniques (e.g., BioID or APEX)

• Computational methods:

  • Molecular docking simulations

  • Protein-protein interaction network analysis

  • Homology-based interaction prediction

When implementing these methods, researchers should establish appropriate controls to distinguish specific from non-specific interactions. For membrane proteins like BMEI0952, detergent selection is critical; a detergent screen should be performed to identify conditions that maintain native protein conformation while effectively solubilizing membrane components .

How can researchers design mutation studies to identify functional domains in BMEI0952?

A systematic approach to mutation studies for BMEI0952 should include:

• Mutation strategy:

  • Alanine scanning mutagenesis of conserved residues

  • Domain deletion/truncation analysis

  • Chimeric protein construction with homologous proteins

  • Site-directed mutagenesis based on predictive structural models

• Functional assays:

  • Antimicrobial susceptibility testing of mutants

  • Membrane localization verification through fractionation

  • Protein stability assessment via western blotting

  • In vivo virulence testing in appropriate animal models

• Analysis framework:

  • Comparison matrix of mutation effects on multiple phenotypes

  • Structure-function correlation analysis

  • Evolutionary conservation mapping to identify critical regions

This approach parallels successful strategies used in studying other Brucella proteins. For example, researchers analyzing the rpoB gene in B. melitensis identified specific mutations (629-Ala (GCG)→Val (GTG) and 985-Ala (GCC)→Val (GTC)) associated with rifampicin resistance . Similar methodical mutation analysis of BMEI0952 could reveal functional domains involved in membrane integrity, protein interactions, or antimicrobial resistance.

What considerations are important when designing expression systems for BMEI0952 functional studies?

When expressing BMEI0952 for functional studies, researchers should address these key considerations:

The expression system should also include appropriate controls, such as vector-only constructs and non-functional mutants, to validate that observed effects are specifically attributable to BMEI0952 activity.

How can researchers effectively design antimicrobial resistance studies involving BMEI0952?

A comprehensive approach to studying BMEI0952's role in antimicrobial resistance should employ these methodological steps:

• Experimental design:

  • Utilize both knockout and overexpression strains of BMEI0952

  • Test against a panel of structurally diverse antimicrobial agents

  • Implement concentration gradients to determine MIC shifts

  • Include reference strains with known resistance profiles

• Resistance phenotyping:

  • Standard broth microdilution assays

  • Time-kill kinetics

  • Biofilm formation assessment

  • Persister cell quantification

• Molecular mechanism elucidation:

  • Transcriptomic analysis to identify co-regulated genes

  • Membrane permeability assays

  • Active efflux measurement

  • Protein localization under antibiotic stress

The multifactorial nature of antimicrobial resistance in B. melitensis necessitates a holistic approach. Studies have demonstrated that AMR did not always correlate with the presence of specific genes or SNPs, underscoring the complexity of resistance mechanisms . Therefore, researchers should avoid relying solely on genomic data and should incorporate phenotypic and functional analyses to comprehensively understand BMEI0952's contribution to resistance.

What is the optimal approach for structural characterization of BMEI0952?

Structural characterization of membrane proteins like BMEI0952 requires multiple complementary techniques:

• Primary structure analysis:

  • Mass spectrometry for precise molecular weight determination

  • Peptide mapping for post-translational modification identification

  • Circular dichroism spectroscopy for secondary structure content

• Advanced structural determination:

  • X-ray crystallography (requires detergent screening and crystallization optimization)

  • Cryo-electron microscopy (particularly suitable for membrane proteins)

  • Nuclear magnetic resonance for dynamic regions

  • Hydrogen-deuterium exchange mass spectrometry for solvent accessibility mapping

• Computational approaches:

  • Homology modeling based on structurally characterized UPF0283 family members

  • Molecular dynamics simulations in membrane environments

  • Topology prediction validation through accessibility studies

The amino acid sequence of BMEI0952 (MSDKTPRKPTAFRLEQPARVSAASEQEEPRRPRAVKDLEQITPQADVFDLTDDEAAELEI LDPAFEAPERKGWSLSRILFGALGILVSFAIGIWTEDLIRALFARADWLGWTALGVAMVA LAAFAAIILRELVALRRLASVQHLRKDAADAAERDDMAAARKAVDALRSIAAGIPETAKG RQLLDSLTDDIIDGRDLIRLAETEILRPLDREARTLVLNASKRVSIVTAISPRALVDIGY VIFESARLIRRLSQLYGGRPGTLGFIKFARRVIAHLAVTGTIAMGDSVMQQLVGHGLASR LSAKLGEGVVNGLMTARIGIAAMDVVRPFPFNAEKRPGIGDFIGDLARLNSDRNARK) provides the starting point for structural analysis . Initial examination reveals hydrophobic regions consistent with transmembrane domains, which should guide the selection of appropriate structural characterization methods.

How should researchers design experiments to investigate BMEI0952's role in Brucella virulence?

To elucidate BMEI0952's contribution to Brucella virulence, researchers should implement:

• In vitro infection models:

  • Macrophage infection assays (survival, replication, inflammatory response)

  • Epithelial cell adhesion and invasion assays

  • Dendritic cell maturation and cytokine production analysis

• In vivo approaches:

  • Comparison of wild-type and BMEI0952 mutant strains in appropriate animal models

  • Competitive index assays to measure relative fitness

  • Organ colonization and persistence studies

  • Histopathological analysis of infected tissues

• Host-pathogen interaction studies:

  • Transcriptomics of host cells during infection

  • Proteomics to identify host targets

  • Immunofluorescence microscopy to track bacterial localization

• Experimental controls:

  • Complemented mutant strains to verify phenotype specificity

  • Heterologous expression in non-pathogenic bacteria to isolate protein function

  • Dose-response relationships to establish biological significance

The experimental design should account for the complex pathogenesis of brucellosis, which involves transmission through direct contact with infected animals or consumption of contaminated animal products . Each virulence assay should be designed with appropriate controls and statistical power to detect biologically relevant differences.

What are the best practices for analyzing gene expression data related to BMEI0952?

When analyzing gene expression data for BMEI0952, researchers should follow these best practices:

• Experimental design considerations:

  • Include minimum three biological replicates

  • Account for batch effects and technical variations

  • Consider temporal dynamics of expression

  • Include appropriate housekeeping genes as internal controls

• Analysis methodology:

  • Normalize data using appropriate algorithms (e.g., RPKM, TPM for RNA-seq)

  • Apply statistical tests with multiple testing correction

  • Validate findings with alternative methods (qRT-PCR, western blotting)

  • Contextualize within broader transcriptomic patterns

• Interpretation framework:

  • Consider genomic context and potential operons

  • Examine co-expression with functionally related genes

  • Relate expression changes to environmental or experimental conditions

  • Integrate with protein-level data when available

Gene expression studies involving BMEI0952 should be designed to capture the complex regulatory networks in Brucella. Previous studies on AMR in B. melitensis emphasized that analyzing individual genes in isolation may not suffice to fully understand the intricate genetic interactions . Therefore, researchers should adopt systems biology approaches that consider gene expression in the context of broader cellular processes.

How can contradictory results in BMEI0952 functional studies be reconciled?

When faced with contradictory findings regarding BMEI0952 function, researchers should:

• Systematic evaluation of methodological differences:

  • Compare experimental conditions (media, growth phase, stress factors)

  • Assess strain backgrounds and genetic constructs

  • Evaluate measurement techniques and their limitations

  • Consider statistical power and data analysis approaches

• Reconciliation strategies:

  • Design bridging experiments that systematically vary conditions between contradictory studies

  • Implement multiple complementary assays to measure the same phenomenon

  • Consider context-dependent functions or condition-specific effects

  • Explore potential compensatory mechanisms or redundant systems

• Meta-analysis approach:

  • Compile all available data on BMEI0952 function

  • Weight evidence based on methodological rigor

  • Identify patterns across diverse experimental conditions

  • Develop integrative models that accommodate apparently contradictory results

The complex nature of bacterial membrane proteins often leads to context-dependent findings. For example, in B. melitensis, mutations in the rpoB gene were observed in both rifampicin-resistant and susceptible isolates, questioning the exclusive role of rpoB gene mutations in conferring resistance . Similar complexity may apply to BMEI0952, requiring nuanced interpretation of seemingly contradictory results.

What emerging technologies could advance understanding of BMEI0952 function?

Several cutting-edge technologies hold promise for elucidating BMEI0952 function:

• Structural biology innovations:

  • Cryo-electron tomography for in situ structural characterization

  • Integrative structural biology combining multiple data sources

  • High-throughput crystallization approaches for membrane proteins

  • Single-molecule techniques for conformational dynamics

• Functional genomics advances:

  • CRISPR interference for precise gene modulation

  • Single-cell transcriptomics to capture population heterogeneity

  • Transposon sequencing (Tn-seq) for genetic interaction mapping

  • Ribosome profiling for translational regulation insights

• Systems biology approaches:

  • Multi-omics integration (genomics, transcriptomics, proteomics, metabolomics)

  • Network analysis to position BMEI0952 in cellular pathways

  • Machine learning for pattern recognition in complex datasets

  • Computational prediction of drug-target interactions

• High-resolution imaging:

  • Super-resolution microscopy for protein localization

  • Correlative light and electron microscopy

  • Label-free imaging techniques

  • Live-cell imaging during infection processes

These technologies should be applied within the framework of a multi-omics approach, as advocated by recent studies on AMR in B. melitensis . Such holistic strategies can overcome the limitations of studying individual genes or proteins in isolation.

How can researchers develop effective collaboration frameworks for BMEI0952 studies?

Effective collaboration on BMEI0952 research requires structured approaches:

• Multidisciplinary team composition:

  • Microbiologists for bacteriological expertise

  • Structural biologists for protein characterization

  • Immunologists for host-pathogen interaction studies

  • Bioinformaticians for data analysis and integration

  • Pharmacologists for antimicrobial development implications

• Standardization and reproducibility:

  • Establish common protocols and reagents

  • Implement interlaboratory validation studies

  • Create shared data repositories with standardized metadata

  • Develop quality control benchmarks

• Knowledge sharing platforms:

  • Collaborative electronic lab notebooks

  • Regular virtual meetings and workshops

  • Preprint circulation before formal publication

  • Open-source analysis pipelines

• Research coordination:

  • Clear division of complementary research questions

  • Integrated experimental design across laboratories

  • Synchronized timelines for dependent experiments

  • Centralized project management

Collaborative approaches are particularly valuable for studying complex systems like AMR in Brucella, where previous research has highlighted the need for comprehensive, multi-faceted investigations that go beyond single-gene studies .